SKU: 87907554442

Mouse CD105, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD105, His tagProduct Specification Species Mouse Synonyms Cell surface MJ7 18 antigen, Edg Accession Q63961 Amino Acid Sequence Protein sequence (Q63961, Glu27 Gly581, with C 10*His)

Product Specification


Species Mouse
Synonyms Cell surface MJ7/18 antigen, Edg
Accession Q63961
Amino Acid Sequence

Protein sequence (Q63961, Glu27-Gly581, with C-10*His) ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 61.7 kDa Observed MW: 75 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Endoglin (ENG) is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex. It is also commonly referred to as CD105, END, FLJ41744, HHT1, ORW and ORW1. It has a crucial role in angiogenesis, therefore, making it an important protein for tumor growth, survival and metastasis of cancer cells to other locations in the body. It is involved in modulating a response to the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, BMP-7 and BMP-9. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87907554442

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Whislin ducks
Waukegan, US
★★★★★ 5
Best that I have found for dry mouth.
These are the best for dry mouth at night. They mostly stay stuck. I say mostly because I have had a few come apart. I think that was my fault.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
F
Verified Purchase
Fabi_Fabz
Phoenix, US
★★★★★ 5
A Must-Read (or Listen) for Every Entrepreneur
Format: Audiobook
This book came highly recommended by a fellow entrepreneur I trust, and I started listening to it almost immediately after purchasing—and I’m so glad I did. Who Not How has completely shifted the way I think about growth, productivity, and collaboration in my business. It's now a staple recommendation I make to all the entrepreneurs I work with. It’s insightful, empowering, and essential for anyone looking to scale their impact by working smarter—not harder. If you’re building a business or leading a team, this one’s a no-brainer. Pros: Powerful Mindset Shift: The central idea—stop asking “How can I do this?” and start asking “Who can help me do this?”—is simple but transformative. It helped me rethink delegation, collaboration, and building a team. Actionable for Entrepreneurs: As someone who works with social entrepreneurs, this book now tops my list of recommendations. It’s a game-changer for anyone feeling stuck, overwhelmed, or trying to do everything themselves. Engaging & Easy to Digest: Whether you’re reading or listening, the content flows well and feels conversational. It’s packed with real-world examples that make the concepts stick.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025
L
Verified Purchase
Linsey R. Mills
Waukegan, US
★★★★★ 5
Business Breakthroughs Await: Unleash the Potential of "Who Not How" in Your Ventures!
Format: Kindle
The impact on business success is exponential for those implementing Dan Sullivan’s “Who Not How” model. The strategic framework presented in the book has fundamentally altered the way entrepreneurs navigate the challenges of running and growing their businesses. The model is a game-changer, shifting from the traditional “how” to the more effective “who.” Below are a few key points: Define Your Unique Value Proposition (UVP): The model encourages businesses to articulate what sets them apart, fostering a deep understanding and effective communication of their unique value. It provides guidance on identifying specific topics and themes that resonate most with the target customers, resulting in a more targeted and impactful approach. Identify Key Tasks: The book prompts entrepreneurs to compile a comprehensive list of tasks crucial for business operations and growth, including marketing, branding, and sales. Categorize Tasks: Categorizing tasks into areas of expertise, such as marketing, operations, content creation, and sales, clarifies resource allocation for optimal results. Prioritize High-Impact Tasks: The model assists in identifying tasks with the highest impact on business growth, such as creating compelling content, building a robust online presence, and securing motivated customers. Identify “Whos”: The transformative recommendation to identify experts or partners for specific tasks has proven beneficial. Hiring specialized individuals, like a virtual assistant for administrative tasks, a marketing expert for online promotion, and dedicated customer service, enhances efficiency and customer satisfaction. Build a Team of Experts: Assembling a team of individuals with complementary skills is a game-changer. Leveraging the efficiency of freelancers, agencies, and part-time professionals fulfills specific roles, contributing to overall business growth. Dan Sullivan’s “Who Not How” model is more than just a book; it’s a strategic guide empowering businesses to leverage expertise and build a team capable of achieving remarkable results. The book is highly recommended to fellow entrepreneurs seeking exponential business growth. ~ Linsey Mills
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2024
M
Verified Purchase
M. Ben-Musa
Whiting, US
★★★★★ 5
Freedom. At last!
Format: Hardcover, Format: Hardcover
Amazing! This book put everything into with great perspective. Stop chasing getting things done that you can have someone else with their genius tackle. It will free your soul and time in ways you can’t imagine. Thank you for the brilliance!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
A
Verified Purchase
Asim Ghaffar
Fort Morgan, US
★★★★★ 4
Unlocking Success Beyond Self-Reliance
Format: Kindle
Dan Sullivan’s book “Who Not How” is a transformative guide that redefines the way we approach challenges and goals. Rather than asking “How can I do this?” the book challenges readers to ask, “Who can help me achieve this?” This shift in thinking opens up the potential for exponential growth, efficiency, and success. Sullivan’s core premise is that the path to achieving your ambitions isn’t about taking on everything yourself but rather identifying the right people who can help you get there. This insight is particularly valuable for those who find themselves caught in a cycle of overwork and frustration when trying to handle every aspect of their projects or responsibilities alone. Although, the main idea of the book is inspiring and powerful, the book does come across as promotion of Sullivan’s Strategic Coach program, which might be off-putting for some readers. While the book is relatively short, it still feels somewhat wordy and could have been more concise. Many chapters follow a predictable pattern: a story about Mr. X who faced a challenge, found a “Who,” achieved success, and then helped the “Who” in return. This repetition can make the narrative feel formulaic at times. Additionally, there are numerous one-liners throughout the book that seem disconnected from the surrounding text. While these sentences are mostly quotable, their placement can feel abrupt and unrelated to the passage before or after. Despite these critiques, the book is filled with examples that showcase how leaders and entrepreneurs have leveraged this mindset. By engaging with the right “Who,” you not only save time and energy but also unlock a level of creativity and collaboration that propels your goals further than you could imagine on your own. For readers seeking to achieve more while doing less, Sullivan’s book is a great read. It offers a liberating perspective that not only boosts productivity but also enhances personal fulfillment by allowing you to focus on what you do best and rely on others for the rest. I would rate it 4/5 for its mostly thought-provoking content.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 10, 2024

recommand products