SKU: 87119004019

Human L-selectin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 26 - Jul 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence

Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87119004019

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
E. L. Romine
Boise, US
★★★★★ 5
Another Good One in the Bag
Format: Kindle
Love the change this adventure keeps taking. We go from our LitFantasy to a comic book adventure. One of the most interesting LIT tales I have read so far. The adventure continues to hold you captured and throws in a few twist. Didn’t see those 3 making an appearance in the Reapers Realm. But, no other spoilers, just read it; it’s definitely worth reading!!! Cheers 🍻 Peace ✌🏾 & Love ❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
K
Verified Purchase
Kindle Customer
Bozeman, US
★★★★★ 5
I love this series
Format: Kindle
I interesting powers and a funny yet cynical main character who loves smack talk and confusing everyone around him , friends included , Jason from the very first book is just thrown into the deep end and told to swim or die , in this book he's back in his world and has to save it and empower his family while protecting them from everybody around them , allies and enemies alike . It's hilarious when Jason decides to mess with people or his own family , it's a serious book as well and lots of action, he's just trying to be what he needs to be for his family and his world , while also trying to leave it a better place before he moves on the the other world he was dumped in , In his eyes he's only back on Earth to fix mistakes and leave his family better off than when he left them , oh and the world too lol . Read it from the first book to the next one in the series , you won't be disappointed, I wasn't, trust me these books are worth it .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2022
C
Verified Purchase
Cori W
Natrona Heights, US
★★★★★ 5
Almost too accurate
Format: Kindle
Another absolutely amazing book in the series, it was scary how exactly on point the actions of various agencies and governments was in this book. It would all play out like this too, absolute chaos for short term gains that in the grand scheme of things mean nothing - almost felt like I was reading "Don't look up" but with gold and silver rankers. As much as I didn't like a certain character and his family, he came through and his private chat brought a tear to my eye. Great job as always, the characters are phenomenal, but like Jason - I'm really ready to be done with Earth, what a dumpster fire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2022
B
Verified Purchase
B
Omaha, US
★★★★★ 4
One Step Too Far But Otherwise Great
Format: Kindle
Huge fan of this series and the multiverse that it has created. I often find find myself laughing out loud at the irreverent main characters quips. I've been five stars all the way for every book so far but I had to drop a star for a very specific reason. This was the first time I was negatively pulled out of the reading experience in this series. (Though, definitely not the first time lol. That totally random, albeit delicious, recipe for lemonade pulled me out that one rime but it wasn't an unpleasant experience). Spoilers follow: Jason's final words to his dead brother's spirit were so inappropriate and crass that I very much hope this isn't the direction that Jason's character is growing toward. I outwardly cringed and had to put the book down for a few days because I wasn't sure this was a character I wanted to continue to read about after reading those lines. Aside from that it was a great book. I truly hope this was a one-off and simply poorly written vs something we can expect more of going forward. Cringe humor can be funny but there's a limit that was drastically overstepped in that line.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
D
Verified Purchase
Deb STL
Lowell, US
★★★★★ 5
Loved it!
Format: Kindle
There seems to be many books out there now with the fake girlfriend/boyfriend, fake girlfriend/girlfriend, or fake fiance/spouse. I actually like this particular trope quite a lot. Some are OK, bad or good. This novel falls in the last category. I really liked this book and will definitely be re-reading it sometime in the future. Tansy and Gemma are very likeable as individuals. As a couple, they have amazing chemistry very early on. One of the best things I liked about this novel is that the author doesn't make us wait until the end of the book for the characters to acknowledge their attraction. They become a true couple early on despite almost everyone thinking it is not real. The writing is well done and I really really liked the main characters. (Have I said that enough times?) There was definitely some heat too! Everything THIS woman is looking for from a romance novel. Definitely recommend. I give it 4 ¾ stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2023

recommand products