SKU: 86338277998

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86338277998

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TX Girl
Lowell, US
★★★★★ 5
Less chemicals than others and it works! Need to sell a larger version however!
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 0.49 Ounce (Pack of 1)
Easy application and excellent for sun protection! One of the "cleaner" ones with less chemicals, but could be cleaner. The tube is very small, so we only use this for face and use Alba Botanica for body. Last time swimming for 1.5 hours, did not burn, while friends who used other sunscreens on their faces were sunburned. Coppertone, please make a bigger tube!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2025
L
Verified Purchase
Lhab
Boise, US
★★★★★ 5
Good stuff
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 0.49 Ounce (Pack of 1)
Good product! Works as it should and the stick in convenient.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
E
Verified Purchase
Erica Fletcher
Louisville, US
★★★★★ 5
Was NOT Moana themed
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 0.49 Ounce (Pack of 1)
Worked perfectly for our Disney trip. Fit well in our fanny packs. Kind of greasy, but its hard to get away from that with sunscreen. Be advised, though, it was NOT Moana. It was just a regular stick. My kids were a little disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
A
Verified Purchase
Ashley
Lexington, US
★★★★★ 4
Perfect little sunscreen
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 0.49 Ounce (Pack of 1)
Easy for my son to apply himself at summer camp. Compact size for his backpack. Only downfall is it goes on white until fully rubbed in, which is normally fine but when my son is trying to get his face himself at camp it is hard for him. Wish it went clear on its own.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
S
Verified Purchase
Sarah Dugre
Waukegan, US
★★★★★ 5
Works very well
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 0.49 Ounce (Pack of 1)
Sent this with my daughter to preschool application was very easy for the teachers. Overall the stick was a little bit smaller than expected but it goes a long ways. Was really happy with the overall ingredients in this product versus others. Well worth the money and my daughter was more open to having it because of the application being in a stick.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2025

recommand products