SKU: 85753129676

Nucleocapsid CTD His Tag, SARS-CoV-2

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Nucleocapsid CTD His Tag, SARS-CoV-2Product Specification Species SARS CoV 2 Synonyms SARS CoV 2 coronavirus NP Protein; SARS CoV 2 np Protein; SARS CoV 2 novel coronavirus Nucleoprotein Protein Accession P0DTC9 Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. Expression System E. coli Molecular Weight 14. 5 kDa () Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g

Product Specification


Species SARS-CoV-2
Synonyms SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein
Accession P0DTC9
Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP.
Expression System E.coli
Molecular Weight 14.5 kDa (还原状态)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 100mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Nucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85753129676

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Ms. Mac
Massapequa, US
★★★★★ 5
Just as good as paraffin wax
Color: Pink & Beige, Size: Medium/Large(fits size 8 to 11)
I might prefer these socks over paraffin wax. They are comfy and very moisturizing. I use these socks once a week to keep the heels and soles of my feet moisturized between pedicures. I rinse with warm, soapy water then hang to dry. They are hard to walk in, but there's a saying printed in the socks that's says something to the effect of "take a break, stay off your feet" lol I love that as a reminder to put my feet up and relax
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
S
Verified Purchase
SKI
Lake Worth, US
★★★★★ 5
Love these!
Color: Pink & Beige, Size: Small(fits up to size 7)
Love these! As I write this review, I’m sitting in my recliner with these on. I have had other silicone socks in the past and would like to share a few of the things that I have learned. These fit great! The others were 2-3 sizes too big because you could not order a size. I wear a size 7 women’s shoe. I got the smaller size. I walked around my apartment in my old ones and they got kinda yucky. Now, I sit in my recliner, put them on and chill for a few hours. I now take them off and put in a ziplock bag so they stay nice and clean (no cat hair!). I use them once a week usually on Saturday or Sunday as I’m a working girl. Also, I use Auqaphor before I put them on and put cotton socks on after I’m finished. Your feet will be SO soft. This is not a one and done…I do this every week especially during sandal season! I know this was lengthy and I hope you got some tips.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
J
Verified Purchase
James B. Ross
Omaha, US
★★★★★ 5
x
Color: Nude, Size: Women 9-13
as described
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
J
Verified Purchase
Joe
Omaha, US
★★★★★ 1
Do not buy these
Color: Nude, Size: Women 9-13
These are terrible. They are designed to walk in. The first day I tried them on I walked about 20 steps and they basically ripped right off my feet. I didn’t think much of it and just thought ok I won’t walk in them I’ll just wear them to bed. The second pair that came with the order I wore to bed that night and woke up with holes tore in them. Terrible product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
K
Verified Purchase
Kevin
Boise, US
★★★★★ 5
Durable
Color: Nude, Size: Women 9-13
These are form-fitting and durable. Wearing these keeps the skin moisturizer in place so it can be effective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products