SKU: 81492767730

TIGIT His Tag Protein, Cynomolgus

Sale price$202.50 Regular price$225.00
Save 10%

Pay in installments of $56.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIGIT His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Amino Acid Sequence Met22 Pro142, with C terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity >90% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Amino Acid Sequence Met22-Pro142, with C-terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH
Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>90% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell immunoreceptor with Ig and ITIM domains (TIGIT), also known as VSIG9, VSTM3, and WUCAM, is a member of the poliovirus receptor family of immunoglobulin proteins. TIGIT is expressed at low levels on subsets of T cells and NK cells, and is upregulated at the protein level following activation of these cells. TIGIT marks exhausted T cells in the tumor microenvironment and during human immunodeficiency virus (HIV) infection. Research has shown TIGIT interacts with several receptors expressed on antigen presenting cells, such as dendritic cells and macrophages, as well as tumor cells and cells of the microenvironment. TIGIT binds with high affinity to PVR/CD155, and with low affinity to Nectin-2/CD112 and Nectin-3/CD113. Upon binding to its ligands, TIGIT suppresses T cell activation, and inhibits T and NK cell cytotoxicity. This inhibition can be blocked using monoclonal antibodies directed at the extracellular domain of TIGIT, resulting in rejuvenated antigen-specific CD8+ T cell responses in tumors and during HIV infection. Three potential isoforms of TIGIT have been computationally mapped.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81492767730

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cody Davis
Charlottesville, US
★★★★★ 5
Great toy
Great toy. My two German shepherds love it and it lasts a long time
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
S
Verified Purchase
SavvvyShopper
Grantham, US
★★★★★ 4
Well Made Toy But My Standard Poodle Chewed Through it Anyway!
We have a standard poodle puppy that chews EVERYTHING! There isn't anything that she can't chew through - leashes, harnesses, toys - you name it and she tears it apart and if it's a toy, de-squeaks it and tears all the stuffing out. She has very powerful jaws! Now I have a couple of other Outward Hound toys that are made only of firehose material and those are still intact. But she loves the feel of the plush toys so I thought this seemed very durable and the inner part was of their Dura-Tuff liner, so I was hoping this would be a win win situation! The toy came and it IS well made and the outside plush is soft and inviting for the dog. Squeakers in every segment is a huge bonus with my dog as she loves squeakers. And no stuffing. Those nice qualities aside, after several weeks, she did manage to rip it apart, shred the material and de-squeak it! For an average dog or puppy, this might have worked wonderfully and lasted the entire lifetime. I still think its a quality made toy, but it just didn't last for my girl!! If this review has helped you in any way, please check yes at the bottom of the review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2016
A
Verified Purchase
Ash
Port Orchard, US
★★★★★ 5
The joy my dog gets from these toys is priceless!
I have a 5 year old Rottweiler, Poppy, who will absolutely annihilate any toy within minutes. I’ve had them all… same outcome. Stuffing all over within seconds and the enjoyment is short lived. I love these toys. There are several squeakers in them so once she gets ones out, she still loves the toy because she can find another squeaker. Also, because it’s long (yet substantially sized) she LOVES throwing them around and whipping them back and forth - something she does even after all the squeakers are gone. That alone makes this toy worth it. She typically no longer plays with toys once the squeaker or stuffing are removed but she will continue to whip these snake toys around and they’re durable. I don’t have to worry about her eating small pieces of cloth that is ripping off the toy. Having said all of that…. I’ve ordered her a few over the last several months and found that these toys are her favorite above all else. I’ve also found them to be a good value for me. But… if I could give these toys 25 stars, I would. My Poppy girl was recently diagnosed with hemangiosarcoma and will have about 6 more precious weeks with us, if we’re lucky. So, I ordered her two more. Because, she can have all the toys, right? And the pure amount of joy that lights up her beautiful face every-time she gets a new snake is priceless. I will absolutely continue to order them to make her remaining weeks as delightful as possible. I will be forever grateful for the happiness these specific snake toys bring my baby girl and could not recommend them enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2025
M
Verified Purchase
MHF-GA
Lowell, US
★★★★★ 3
Not so great for aggressive chewers!!
EDIT: well it’s been two days. My boy (American Staffordshire Terrier) has broken one of the squeakers and has made a Hole. Even tho he LOVES this toy and has been carrying it around the house it’s not for aggressive chewers. It’s pretty tough.. tougher than most but not Black Kong Tough. (Wykyk)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
S
Verified Purchase
Sarah
West Palm Beach, US
★★★★★ 1
My little buddy loves it! (Loves it no more)
I ordered this in advance of the arrival of my 11 wk old Corgi pup. Not knowing what kind of a chewer I was getting, I wanted something that squeaked but did not have too many extremities to rip and tear at. I also didn't want too much stuffing to end up all over my house and in my buddy's tummy. It is soft and well constructed. I like that the snake is compartmentalized so that if one segment is breached, the others are not. As it turned out, at this time, my pup is not a violent ripper (except for with paper and cardboard). After a week of testing, it is his favorite toy. It took him about two days to figure out how to squeak it and boy does he love it. It is the only toy he will haul around, which is hilarious because its bigger than he is. It is also the only toy that he will play fetch with. I'm also working on "leave it" with the with him. Nemo chews a lot, but hasn't shown much interest in ripping at his toys, so after a week (if it were washed) it could probably pass as new. I also try to switch him over to a bone or rubber toy when he starts getting really excited. I am weary since my last dog was a lab who would shred her toys in seconds. Nemo was ripping at the tag (something about paper) so I cut that off to prevent a seem getting opened up. I'm surprised that the tongue is still intact. The tongue and eyes are weak links and Nemo does like to chew on them. Overall, I'm very pleased with this toy. My husband was skeptical and thought it a bit ridiculous, but even he has decided it was a good buy. *Update* Our original snake lasted 7 months. Nemo loved it. He would carry it around with him and squeak it till my husband and I went insane. He had mastered the rapid fire squeak. It was also the only toy he would reliably fetch. After 7 months my pup had punctured two of the squeakers and the fur was getting threadbare in some place. But overall we were very happy with the product. Last week we had a guest GSP at our home and he demolished the toy within minutes. Shredded all of the squeakers and the casing. So we were forced to get Nemo a new one. Unfortunately they have since changed the design. There is now a piping that goes all the way around the snake (before it was blind stitched). Nemo has a thing about tags and edges, he works slowly and methodically to nibble them off. Once the piping was compromised, Nemo had easy access to the squeakers. This new version of the toy lasted only a few hours. I am extremely disappointed with the changes made. I have reduced my 5 star review to 1 star and will no longer recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 6, 2013

recommand products