SKU: 74907072682

Human TMED4 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TMED4 Protein, His TagProduct Specification Species Human Synonyms Transmembrane emp24 domain containing protein 4, Endoplasmic reticulum stress response protein 25 (ERS25), GMP25iso, Putative NF kappa B activating protein 156, p24 family protein alpha 3 (p24alpha3), ERS25 Accession Q7Z7H5 Amino Acid Sequence Protein sequence (Q7Z7H5, Leu30 Arg194, with C His Tag)

Product Specification


Species Human
Synonyms Transmembrane emp24 domain-containing protein 4, Endoplasmic reticulum stress-response protein 25 (ERS25), GMP25iso, Putative NF-kappa-B-activating protein 156, p24 family protein alpha-3 (p24alpha3), ERS25
Accession Q7Z7H5
Amino Acid Sequence

Protein sequence (Q7Z7H5, Leu30-Arg194, with C-His Tag) LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Expression System HEK293
Molecular Weight Predicted MW: 20.9 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Transmembrane emp24 domain-containing protein 4 (TMED4) is a member of the p24 family of type I transmembrane proteins, which are involved in endoplasmic reticulum (ER)-to-Golgi vesicular transport. It functions as a cargo receptor, facilitating the selective packaging of glycosylphosphatidylinositol (GPI)-anchored proteins and other specific clients into COPII-coated transport vesicles. TMED4 forms hetero-oligomeric complexes with other family members to ensure efficient cargo sorting and maintenance of cellular homeostasis. Its role is crucial for proper protein secretion and cellular trafficking pathways. Dysregulation of TMED4 has been implicated in certain diseases, including cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74907072682

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bret BigDawg
Lexington, US
★★★★★ 5
Well made, sturdy, and work great!
Work great for our KEF bookshelf speakers, would definitely buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
C
Verified Purchase
Colby D. May
Alexandria, US
★★★★★ 4
Almost perfect, absolutely fit for purpose, and a great value
Size: Standard--black
These are really, really close to being five stars, but because of my OCD tendencies when it comes to things being true and level, I can only go four. The way these mounts are made, speakers rest inside and on the inner surface of the L-shaped adjustable side brackets, and not on the large metal plate between them. Leveling on the fore-and-aft plane can easily be handled via the adjustment nut on the bottom of the bracket. But there is no provision for side-to-side leveling, so if the manufacturing of the side brackets is not within tolerance, you'll wind up with a speaker that's ever-so-slightly wonky...which is the case with ONE of my mounts. The bubble is still between the lines, but it's kissing the left line. Most would not care about this, and I'm not too bummed about it, but I am able to see that much out-of-true with the naked eye. It's not enough to pursue any kind of remediation, because the value on these really is awfully good. They are solidly built, easy to install, and easy to adjust. The manufacturer is apparently improving the product as they go based on feedback, as some issues that have vexed other owners have not been a problem for me, such as the wall plates being or coming loose (the design now ensures they stay put once pushed back to the wall), or the adjustment nut and bolt rotating freely and not staying tight (the ones on mine are great and function as intended). For the price, these are really hard to beat, and I have a feeling all the mounts like this with the different oddly-named brands are made in the same factory. That being the case, get the cheapest ones, and the day I bought mine, these were those.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2025
S
Verified Purchase
Seth Johnson
Phoenix, US
★★★★★ 5
Solid and easy to install
Size: Standard--black
These are nice, solid wall mounts. They assembled quickly and easily, and they can hold larger bookshelf speakers like my Cambridge Soundworks M60s. Adjusting the plate to match speaker size is pretty easy, and they seem to grip the speaker tight enough that they won't fall off. The tilt option is very useful and a good feature when speakers are mounted high and need to tilt down toward the listener. Just remember to tighten the bolt on the bottom once you've positioned it where you want it. I would definitely recommend these to anyone looking for solid, well priced speaker mounts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
M
Verified Purchase
Mark K
Charlottesville, US
★★★★★ 5
Well made. Easy install.
Size: Standard--black, Size: Standard--black
These were easy to install. All the hardware was included. They look good. Seems well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
O
Verified Purchase
Optionado
Lake Worth, US
★★★★★ 5
Sturdy solution
Size: Standard--black
I needed a way to mount rear speakers and this was the solution. They're sturdy and adjustable to fit reasonably sized speakers. They also pivot up and down and swivel so really perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026

recommand products