SKU: 71128672547

Human Lambda, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 27 - Aug 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lambda, His tagProduct Specification Species Human Accession P0CG04 Amino Acid Sequence Protein sequence(P0CG04, Gly1 Ser106, with C 10*His) GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 13kDa Actual: 17kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Accession P0CG04
Amino Acid Sequence

Protein sequence(P0CG04, Gly1-Ser106, with C-10*His)
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). There are two types of light chain in humans: kappa (κ) chain and lambda (λ) chain. Individual B-cells in lymphoid tissue possess either kappa or lambda light chains, but never both together. Specific rearrangement of lambda light chain of immunoglobulins can lead to loss of some protein coding genes. Using immunohistochemistry, it is possible to determine the relative abundance of B-cells expressing kappa and lambda light chains. If the lymph node or similar tissue is reactive, or otherwise benign, it should possess a mixture of kappa positive and lambda positive cells. If, however, one type of light chain is significantly more common than the other, the cells are likely all derived from a small clonal population, which may indicate a malignant condition, such as B-cell lymphoma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71128672547

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yu-Chun Cheng
Dallas, US
★★★★★ 5
Really nice and affordable vacuum!
Color: White, Size: D20Plus, Color: White, Size: D20Plus
I’ve been looking to upgrade my vacuum robot for a while. I came across this vacuum, it is affordable and comes with the features that I’m looking for. The strong suction, hair detangle brush (critical if you have long hair) and easy mapping. It honestly made daily cleaning so much easier. The suction power is seriously impressive. It picks up dust and crumbs and I love how it auto emptied the dust bin. Also I have hard floor at home and I’m loving the mopping function. I love how I don’t have to vacuum and mop the floor by myself anymore! Would recommend this robot to people that are looking for an affordable option!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
R
Verified Purchase
R. G.
Dallas, US
★★★★★ 4
Decent vacuum/mop for the price
Color: Black, Size: D20Plus, Color: Black, Size: D20Plus
We have had this vacuum for a couple of months now and can now give it an honest review. The good: cleans well, good suction power, durable, manages changes in floor height fairly well, attractive (for a robot vacuum), programmable, great mapping The bad: noisy, muffled voices, cumbersome to program initially, app is not the most user-friendly, does not like rugs with a higher nap. Some tips: 1) If you have pets, be cautious of the cleaning solution. Make sure it's pet safe. 2) For pets and children- Remember to pick up any toys before the cleaning cycle begins. The vacuum will try to eat smaller, flat or string toys, and you will end up with a wrapped brush notification. 3) When mapping for the first time, remember to close doors to any rooms or exterior areas you do not want vacuumed or mopped.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
U
Verified Purchase
Ucant wait 2buy
Lexington, US
★★★★★ 5
Excellent for vacuuming with a great app
Color: White, Size: D20Plus
This thing is just awesome. I gave her name and some googly eyes, and now she is my official cleaning lady. Does a great job with dog hair which was the main reason for the purpose. I was vacuuming all the time. I have hard floors and 3 dogs one of which is a golden retriever that sheds like crazy. The D20 does really great getting up the pet hair along with other stuff in the floor. I have a couple area rugs as well as thick mats in front of the front and back doors, and she does great on both. I definitely make sure to get up any cables or little things like door stops as she will get caught up from time to time. The app works great and does a good job of sending alerts when there is an issue. It lets you know if it’s hung up on something, stick on an edge and if the cleaners are tangled up underneath along with other things. It’s really easy to flip over and take off the brushes to clean them out and untangle them, and easy to put it all back together. You can also schedule her to clean any time of day / night and customize how it cleans certain areas. I prefer to let her run late at night while me and the dogs are sleeping, and she gets the house done in about 90 minutes and covers a lot of ground. She’s also surprisingly quiet for as much as she is picking up. If I’m already awake, I can hear her start to roll around upstairs. But I’ve never been woken up by her, nor have my dogs. I have never used the mop feature as I bought it only for the vacuuming. From what I’ve read it seems there are better options for mopping. But as far as vacuuming goes I am super happy with her! I was vacuuming 3-4 times a week and would usually mop every other week, if ai could get away with it. Now I vacuum and mop once every two weeks, and Dreame does a wonderful job keeping the place clean in between my bi-weekly cleanings. The D20 was a great purchase and a major time and energy saver for me!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
S
Verified Purchase
SF
Charlottesville, US
★★★★★ 1
Useless
Color: White, Size: D20Plus
Well so far unable to actually use it to see how it works. I have to split my wifi every time I want to use it. It won't charge even when it's on the dock. When I push "charge" on the app it comes off the dock instead of recognizing that it's already on it and proceeds to roam around the house looking for the docking station that it just left. If it can't even find the docking station while sitting on it how can it properly clean the house? I just bought this after returning a defective AirZeen model. Looks like Shark may be the only way to go. Starting yet another return. These are useless
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
J
Verified Purchase
Jerry
Lake Worth, US
★★★★★ 5
Great Cleaning Power and Super Convenient
Color: White, Size: D20Plus, Color: White, Size: D20Plus
The DREAME D20 Plus Robot Vacuum and Mop works really well in my apartment. The suction is very strong and easily picks up dust and pet hair from both carpets and hard floors. I also like the self-emptying feature with the large dust bag, which saves me a lot of time. The mapping is accurate, and the battery lasts long enough to clean the whole place. Overall, it’s a great robot vacuum for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products