SKU: 71006314223

Mouse CD137, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD137, His tagProduct Specification Species Mouse Synonyms 4 1BB ligand receptor, T cell antigen 4 1BB, Tnfrsf9, Ila, Ly63 Accession P20334 Amino Acid Sequence Protein sequence (P20334, Val24 Leu187, with C 10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19. 2 kDa Observed

Product Specification


Species Mouse
Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, Tnfrsf9, Ila, Ly63
Accession P20334
Amino Acid Sequence

Protein sequence (P20334, Val24-Leu187, with C-10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.2 kDa Observed MW: 28, 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD137, a member of the tumor necrosis factor (TNF) receptor family, is a type 1 transmembrane protein, expressed on surfaces of leukocytes and non-immune cells.[1] Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB, and induced by lymphocyte activation (ILA). It is of interest to immunologists as a co-stimulatory immune checkpoint molecule, and as a potential target in cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71006314223

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeanie
Lexington, US
★★★★★ 5
Yes!
Format: Paperback
Love praying through this book over all who need healing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
C
Verified Purchase
Cheralee Covell
Omaha, US
★★★★★ 5
Excellent
Format: Paperback
Love the degrees. Scripture based and any illness is addressed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2025
T
Verified Purchase
Theresa Parsons
Massapequa, US
★★★★★ 5
This is About The Absolute Truth of Almighty God, Revelation knowledge when your devoted 100%
Format: Paperback
Amanda Grace, a. True servant Prophet of God well-written book not about human truths but almighty God and His truth. The forward written by the daughter of prophet Kim Clement House of destiny, Donné Clement Petruska also of code breakers where breaking down prophecies is like a well-woven tapestry the revalutionary war the epic Battle, confirms prophecy after prophecy and it is truly a tapestry that takes time. I highly recommend this book. If I could give it 10 Stars I would product availability? Durability of the book shipping. Excellent on time. Cost perfect. For readers for individuals, new Faith and old alike, given the time frame the author, it is well written. The next book is already on the market and all I can say is Amanda. Grace has outdone herself again. She is a true prophet of God, a teacher, a minister, and a well documented servant. The prophet of Almighty God. I encourage anyone to purchase this wonderful book, Amanda is also the CEO of Ark of Grace animal sanctuary and what a variety of animals she has. She truly is a a blessing to others and does carry the mantle of Kim Clement. She has a Proven Record of The Prophetic Calling, and a True Witness and Testimony for what God has done for her.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026
C
Verified Purchase
Creative Gabby Girl
Boise, US
★★★★★ 5
The Epic Battle Against False Prophecy and Deception: The Revelationary War
Format: Paperback
In the beginning of the book, The Revelationary War, the author, Amanda Grace uses the bible verses Amos 3:7, Genesis 1:29 & Gen 2:16-17 to introduce the title of her book. She explains that prophecy is not just about revealing and revelation-it is an announcement of the thoughts, plans, purposes, and jugments of God. She goes on to say that at its basic, prophecy is an announcement from God. It can contain instructions, plans, encouragement, judgments, blessings, revelations, and anything else that God wants to announce to His people. She also explains that what is happening now is a direct result of what happened in the Garden of Eden. The author says, "It is time to sharpen our discernment and confront the counterfeits invading the church!" The author goes on to explain that there is an Epic Battle going on! The Revelationary War is a battle between what is false & what is real. The book has 12 chapters. The first chapter starts with "What is Prophecy?" and ends with chapter 12 entitled: The challenge and the Choice. The author uses bible verses all throughout the book. She uses it to back up and explain what we are seeing today and how it all follows a bibilical cycle. If you understand the biblical cycle we are in, you will then be able to understand where we are on God's timeline. The author also shares a few of her own personal experiences & how God used them to teach her and train her. What I discovered and learned: ●Knowing the difference between The Gift of Prophecy and The Office of a Prophet ●Understanding the difference between a SHOWMAN & a SHEPHERD ●How to identify the telltale signs of false prophets and recognize true prophecy when you hear it ●How to Avoid con artists, psychics, witchcraft, and divination disguised as prophetic or deliverance ministries ●Why discernment in the Body of Chist is lacking and what we can do to sharpen our discernment ●How Technology and Media work hand in hand and play a part in prophecy and what we should pay attention to As you dive into this book, be prepared to hear the truth! I purchased the paperback edition because I wanted a hard copy, not digital. From what I understand, this is Amanda Grace's first book! Being a follower of her X account and watching her LIVE broadcasts, I was very interested in reading it. I found this book to be full of Godly biblical wisdom, and knowledge into the world of the Prophectic. You will discover how biblical cycles play a very important part in prophecy and how to understand where we are on God's timeline. You will also learn how the enemy has infiltrated the churches and the difference between the showman and the sheperd! When I finished the book, I went back and read it a second time, taking notes and highlighting all the things that I felt were important. I have to say that the second go around, I even gleened more knowledge! Amanda has a passion for bringing people the truth of God's word and helping those who have fallen into the trap of being deceived! She has a true love for God's people, and she shares her knowledge & experience to help others who are eager to learn. Her in-depth knowledge of the prophectic is a tool that every christian should desire. I highly recommend this book to anyone who is interested in learning the truth of God's word and desiring to know how the prophetic works. * I did not receive any compensation for writing this review. I purchased this book because of my interest in the author and what she has to say about the prophectic. This review was based totally on my own views and what I learned & discovered from reading this book. I learned so much! I believe that anyone who is looking for the Truth in God's word and how prophecy plays an important part in every believer's life should read this. Thank you, Amanda, for writing this book! I believe it is a timely piece that God will use to help others understand the prophectic and the times we are living in. God Bless You!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2025
N
Verified Purchase
Noel
New York, US
★★★★★ 5
Interesting and enjoyable. Looking forward to the 2nd part this year.
Format: Paperback
I enjoyed the book. It's an interesting book on topics that will be very unfamiliar with many people. Because of my own point of view and experience, I would expect that many people would be scoffers. I would have been before my journey changed direction a few years ago. I watch the podcast by Amanda Grace / Ark of Grace on rumble . Com. I have been watching for two years. It was curiosity at first. After a few months of watching, I was blown away by the statements made, months in advance, happening sometimes exactly word for word, other times so close that when I hear an report on TV or radio or immediately reminds me of what I heard on Ark of Grace weeks or months before. It definitely has opened my mind to dig deeper into the word and turn to Him for insight into things I had previously never considered. In the periods of my active faith in my life, I don't remember people speaking about or believing in the power of modern prophetic word or direction by God, except one denomination that I took part in for a couple years. I have to heard more than wants that signs and wonders are no longer present in the modern world which is strange because we were previously, up to and even after the resurrection. It's strange logic to me that that would be impossible these days. It's just what I always heard aside from the one denomination and when I was going to that type of church, I was skeptical about that part because it was unusual for me. One thing I have learned is that nearly EVERY article of faith that ANY denomination or has, there are others that object to that principle. For example: Saints, prophecy, Trinity, purgatory, baptism significance/timing, gifts of the Holy Spirit, speaking in tongues, covenants in regards to Jew/Gentile, Sabbath day, day and celebration of birth and resurrection days, etc etc. If you consider, that almost every denomination and faith has important pillars of belief that are rejected by OTHER denominations of the same body of the church, there is a lot that we have varying beliefs on in the same religion. I believe the answer is to always turn to Him in faith, guidance and surrender. I try to remember that although the many churches of the faith have many differences, they are all part of the body of Christ and under his authority, not for us to decide which branches are to be removed. It is for us to be faithful to the best of our ability, and to share the light, not try to disown others who practice in their GOOD faith but understand some things differently than we do. (I'm talking about practices not blasphemy) [Luke9. 39Now John answered and said, “Master, we saw someone casting out demons in Your name, and we forbade him because he does not follow with us." 40But Jesus said to him, “Do not forbid him, for he who is not against us is on our side.”]
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025

recommand products