SKU: 68803853175

Human CD326/EPCAM, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326/EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence (P16422,

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 32,33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM), also known as CD326 among other names, is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68803853175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shanny
Phoenix, US
★★★★★ 4
Fabulous and sooooo soft
Color: Tie-dye Khaki, Size: Throw(50"x60"), Color: Tie-dye Khaki, Size: Throw(50"x60")
This blanket is so extremely soft and cozy. The only reason I deducted a star was because the fur side and the velvety side aren’t sew together anywhere besides the edges/seams, so when I fold it it’s basically like 2 blankets just sewn together and not one blanket. When you lie with it and cover you, they sort of separate if that makes sense but it doesn’t bother us. It’s so comfy to have on the couch and while movie watching. The only time it sort of a pain is when I fold it. In saying that, I would buy again. The velvety side is a soft tan/beige and the fur side is creams, off white and variations of the tan/beiges. So lovely. You can see it next to a solid cream colored blanket I have that I also bought on Amazon. It matches well and I love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2025
T
Verified Purchase
Tracy Allen
Draper, US
★★★★★ 5
This one is really soft
Color: Tie-dye Khaki, Size: Throw(50"x60")
This is actually baby bunny soft! I was very pleasantly surprised. The top side is plush and the bottom side is smooth but in a velvety suede type smooth. It is very well made and after machine washing and drying it several times it still looks and feels new.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
J
Verified Purchase
Jillian Faulkner
Phoenix, US
★★★★★ 5
Cozy, cozy, cozy!
Color: Tie-dye Sage, Size: Throw(50"x60")
So soft!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
A
Verified Purchase
April B
Boise, US
★★★★★ 5
The blanked you never knew you needed
Color: Tie-dye Gray, Size: Twin(60"x80")
I originally ordered a blunique heated blanked and loved it so much I got this throw for the couch. I love it so much it has since been moved into my bedroom and I will be ordering extras for guests as well as to keep on the couch. The color is beautiful, and the faux rabbit fur is so incredibly soft. I snuggle this part of the blanket next to my face when I sleep and am immediately out. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026
J
Verified Purchase
Janeah
Bozeman, US
★★★★★ 5
Beautiful scented candle sage.
The candle itself is a lovely scent of sage and salt. The size is larger than expected and is a good value for the money. I like the blue green glass and it’s beautiful to look at when not lit Even. It came in a nice packaged Blue box. But the bottom of the box was coming apart and it would not have been acceptable to give as a gift In the original Box it came in.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2024

recommand products