SKU: 66107966938

LAG-3 GST Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3 GST Tag Protein, HumanProduct Specification Species Human Antigen LAG 3 Synonyms LAG 3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG 3 Accession P18627 Amino Acid Sequence Leu23 Leu450, with N terminal GST Tag

Product Specification


Species Human
Antigen LAG-3
Synonyms LAG-3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG-3
Accession P18627
Amino Acid Sequence

Leu23-Leu450, with N-terminal GST Tag

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSDDDDKLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL


Expression System HEK293
Molecular Weight 75-80kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Colin G. Graydon, Shifa Mohideen and Keith R.Fowke, LAG3’s Enigmatic Mechanism of Action. Frontiers in Immunology

Background

LAG3 is a member of the immunoglobulin superfamily and a CD4 ancestral homolog, resulting from a gene duplication event. Like CD4, LAG3 binds MHC class II (MHCII), but also FGL-1,α-synuclein fibrils (α-syn) and the lectins galectin-3 (Gal-3) and lymph node sinusoidal endothelial cell C-type lectin (LSECtin). As an immune checkpoint, LAG3 inhibits the activation of its host cell and generally promotes a more suppressive immune response. On T cells, LAG3 reduces cytokine and granzyme production and proliferation while encouraging differentiation into T regulatory cells.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66107966938

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KB2187
Natrona Heights, US
★★★★★ 5
Vader's Second Marvel Series Is Good!
Format: Paperback
This is actually the start of a second Vader series. The first one began, along with the new Marvel main Star Wars series, right after the Death Star was destroyed. That Vader series birthed the new characters of Doctor Aphra, Triple Zero, BeeTee, and Cylo. Now, that series has come to an end. THIS NEW SERIES IS GOOD! It picks up the moment that Anakin Skywalker awakes in his armor at the end of Revenge of the Sith. It chronicles the first steps of Darth Vader. We learn something new about the Sith. They do not create their own lightsabers. They must take a saber from a Jedi and make it their own. The Sith blades are red and only red. Why? Palpatine explains that the kyber crystals that power the sabers are living things within the Force. This is backed up by the Rogue One novel (it was either that or Catalyst). The crystals are rock, but they are also alive. In the hands of a Sith, the new owner uses the Dark Side to push all his pain into the crystal--until the crystal bleeds and turns the color of the beam red. I just think that is all sorts of awesome!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2018
P
Verified Purchase
PWDecker
San Leandro, US
★★★★★ 5
Vader when he still is Anakin
Format: Paperback
This comic picks up right where Episode III left off. Like directly. There's the whole "Noooooooooo" thing and everything. I liked seeing Vader when he is new to being a Sith. It really is Anakin under there still. Throughout the comic, that Anakin begins to fall away. I liked the mix of prequel and original trilogy aesthetic. Seeing Vader alongside clone troopers was very cool. The Grand Inquisitor even makes a cameo! I read the Dark Horse comics that took place right after Order 66 so certain aspects of this comic remind me of those. In this comic, there are jedi who took the Barash Vow prior to the Purge, so they are still out and about in the galaxy. Vader takes this opportunity to take a lightsaber and make it bleed. I really enjoyed this first volume in a new, ongoing comic series. I am absolutely excited for volume two. I give this volume a 5/5.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2017
F
Verified Purchase
Fred
Los Angeles, US
★★★★★ 5
The Lord Vader Treatment
Format: Kindle
Love this Darth perspective. It potentially fills in some gaps in the timeline in the beginning of his transition. Loved the humor and the art.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
C
Verified Purchase
Cargyll
Bozeman, US
★★★★★ 5
Great addition to my collection
Format: Hardcover, Format: Hardcover
Came great as I hoped and looking forward to the Vol. 4 reprint in November (the Green Arrow nearby was another purchase i made that got packed together)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
N
Verified Purchase
@nancis_reads
Belleville, US
★★★★★ 5
A true Meghan Quinn masterpiece!! 😂✨
Format: Audiobook
🎧 Rules for the Summer by Meghan Quinn Narrated by Stella Hunter, Shane East, Cassandra Medcalf & Gary Furlong A true Meghan Quinn masterpiece!! 😂✨ I laughed my a** off from beginning to end, and the narration honestly could not have been more perfect. Every narrator absolutely nailed their character and brought all the chaotic, hilarious, emotional, and spicy moments to life so well that I never wanted this audiobook to end. And the accents?! Absolute chef’s kiss 🤌🔥 They made the listening experience even more fun and immersive. Theo and Henley were such a fun couple to follow. The banter, chemistry, tension, and absolute ridiculousness between them had me smiling nonstop. And Aunt Kitty and Rupert? ICONIC. Honestly, they stole so many scenes for me and added even more humor and heart to the story. This book had me laughing out loud one minute and fanning myself the next 🥵😂 The spice was definitely A LOT… but honestly, are we even surprised when it comes to a Meghan Quinn book? She always delivers the perfect mix of humor, romance, chaos, and steam. The audiobook production was phenomenal. Stella Hunter, Shane East, Cassandra Medcalf, and Gary Furlong made this story feel so immersive and entertaining. Their performances elevated an already fantastic story into one of those audiobooks you just never want to stop listening to. Absolutely loved this story and highly recommend the audiobook version! Happy Reading/Listening 🎧📚
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products