SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on salfueradeti.es >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 2326 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
John
Phoenix, US
★★★★★ 4
Has fit perfectly into my morning espresso
Color: Black&Silver
This seems to me to be an excellent small kitchen scale. I am new to the complexities of espresso making and have begun using this scale every morning to measure my dose and output. It is working just fine. Easy to operate, keep clean and store. I did not give it 5 stars because I have limited comparisons but I don’t expect and will not bother looking for anything better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
D
Verified Purchase
D. Lakin
Grantham, US
★★★★★ 5
Perfectly fits what I needed for my espresso habit!
Color: Black&Silver
This Maestri House mini coffee scale is a great little tool for espresso and pour-over. The size is compact enough to fit under a portafilter or cup, and the 0.1g accuracy makes dialing in coffee much easier. I like the built-in timer, rechargeable USB-C battery, and clean black-and-silver look. It feels precise, practical, and easy to keep near the espresso machine. Great value for anyone who wants more consistent coffee.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
B
Verified Purchase
B. Swenson
Carnegie, US
★★★★★ 5
Maestro House Mini Coffee Scale
I have begun to drink tea, pu’erh tea to be specific. I have several varieties and I have had a problem with getting consistent results. The varieties can be very different in size depending on when the leaves are harvested (leaves harvested in spring are much smaller). So the easiest way to get consistent results is by weight. This scale is very easy to use with a ceramic tea scoop, set the tea scoop on the scale, zero it out and add tea leaves. This has made my results much better, without the wild swings in strength I had been getting before trying to eyeball even measures. This scale gives me accurate measurements to one tenth of a gram.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
B
Verified Purchase
bicyclemayhem
Whiting, US
★★★★★ 4
Mostly great, except one little annoyance
Color: Black&Silver, Color: Black&Silver
Pros- lightweight, small, very accurate, easy to clean, timer included. Cons- I use this to brew espresso on my Breville Touch and to get an accurate reading, you have to place something flat (structured) under the scale. Otherwise the reading just jumps all over the place. I know lot of espresso machines have the same base, so this might be an issue for some! This is my reason for 4/5 stars. It’s an easy fix, it’s just kind of annoying. Value for the price seems to be on point. It’s easy to clean. It has a timer as well as scale (nice for espresso). Buttons work the first time you push them. That’s it that’s all
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
E
Verified Purchase
Eglantine
Dallas, US
★★★★★ 5
Great taste
Flavor Name: Ceremony Matcha-1.06oz
Great quality matcha. It came with a cute little metal spoon. The color was bright green, just the way its supposed to be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026

recommand products

Honk Guns Fired From a Motorcycle Biker Mens Long Sleeve T-Shirt
11.49
Steampunk Cross Gothic Heavy Metal Biker Mens Ringer T-Shirt FotL
10.49
Ensemble 2 pièces - PL Baby - 12 mois (légèrement mousseux)
12.00
Native - C4
24.50
Maillot de bain - H&M - 2-4 ans
10.00