SKU: 64447018498

Human CBP, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CBP, His tagProduct Specification Species Human Synonyms CREB binding protein, Histone lysine acetyltransferase CREBBP, Protein lysine acetyltransferase CREBBP, CREBBP, CBP Accession Q92793 Amino Acid Sequence Protein sequence (Q92793, Thr144 Ser417, with C 10*His)

Product Specification


Species Human
Synonyms CREB-binding protein, Histone lysine acetyltransferase CREBBP, Protein-lysine acetyltransferase CREBBP, CREBBP, CBP
Accession Q92793
Amino Acid Sequence

Protein sequence (Q92793, Thr144-Ser417, with C-10*His) TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.9 kDa Observed MW: 43-90 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CREB-binding protein, also known as CREBBP or CBP or KAT3A, is a coactivator encoded by the CREBBP gene in humans. CBP has intrinsic acetyltransferase functions; it is able to add acetyl groups to both transcription factors as well as histone lysines, the latter of which has been shown to alter chromatin structure making genes more accessible for transcription. CBP alone has been implicated in a wide variety of pathophysiologies including colorectal cancer as well as head and neck squamous cell carcinoma. In these diseases, association of CBP with β-catenin has been shown to promote cancer cell proliferation and disease aggressiveness, whereas p300/ β-catenin leads to cell differentiation and/ or apoptosis. CBP has also been shown to help modulate liver function via maintenance of energy homeostasis in response to changes in cell nutrition conditions by regulating the activity of transcription factors and genes responsible for lipogenesis and gluconeogenesis. CBP is also implicated in the etiologies of several other diseases including hematologic malignancies and other solid tumors, diabetes, schizophrenia, Alzheimer's disease, depression, and many other neurological conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64447018498

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natalieus
Carnegie, US
★★★★★ 5
Great weed wacker!
Style: String Trimmer
BLACK+DECKER Weed Wacker with Auto Feed, corded 14-Inch 2 in 1 String Trimmer Lawn Edger, Powerful 6.5-Amp. I recently purchased this trimmer and really like it. It took less than a minute to set up, and the adjustable height and handle make it very comfortable to use. It easily rotates between a string trimmer and a wheeled edger for clean lawn borders. I did go through two spools of line for 7,000 sq. ft. of grass, but for the price, it’s a very impressive tool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
J
Verified Purchase
jack
Houston, US
★★★★★ 3
Serves its purpose-EDIT
Style: String Trimmer
Experience as of 8/1/24 Pros: ease of use, weight, power, price point. Cons: There is no way to get out of spending a fortune on string. Manufacturer defect why this is so cheap & discontinued. Shame on them. I've tried everything in my unknowledgeable unprofessional experience. Silicone spray lube does help & plastic core has to be in like new condition - not even slight wearing. I've bought hardcore string, still rolls out too fast & gets stuck a lot because motor can't handle & tends to heat up string which causes it to bind. I've tried removing auto feed lever & auto cutter, worse. Kept past 30 days & tinkering voids my warranty. If $ spent on buying exorbitant amounts of string is not a concern, everything else is perfect. I have an old B&D from the early 2000s still kicking grass. I just hate batteries. So I can either buy a new weed whacker or buy batteries. 3.75 stars Pros: Great power even with 200 ft cord (use proper cords). Works quickly & efficiently & powerful. The edger works outstanding. Used around chain fencing hard rocks & blacktop. Normal to high grass up to 12 in. adjustable Lightweight & easy to operate for a 62yo 5'2" female. Cons: using electric cord was a pain for me but once get used to it no matter. The string automatically feeds but extremely fast. I believe it has to do with where & what you're up against. Many many times I had to stop & adjust the string roll. I found if ur careful about inserting properly & hearing the click it works better but again if you're operating under more than moderate conditions it seems to stick more & you have to adjust. That seems to be a design flaw in manufacturers use of cheaper materials. The string it comes with is extremely short & runs out quickly. Based on other correct reviews I bought a B&D refill 3pack. Not the best either. I used all 3 rolls in 2.5 rounds of 1/4 acre back yard (hard conditions) & 1/8 acre front yard & blacktop edging. Better off buying bulk cheaper $ & restringing roll cores. I believe this also has to do with conditions of use and the B&D string is not any stronger than discount string. I purchased a bulk tougher string & will see if there's any difference in quantity usage. This is not the best but not the worst. There are hardly any corded options for weed eaters but I was determined to stay with corded option because batteries are so unreliable these days. Product still a good value for the price. Disclaimer only sporadically using battery weed eaters a few years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 19, 2024
C
Verified Purchase
Christopher
Battle Creek, US
★★★★★ 5
Great edger for home use
This WORX 12 Amp Electric Lawn Edger did exactly what I needed it to do. It was easy to use, had plenty of power for cleaning up the edges around my driveway and sidewalk, and gave the yard a much cleaner, finished look. I like that it is corded because I do not have to worry about batteries dying, and it has enough power for regular homeowner use. The first pass took a little extra time since the edges needed cleaned up, but once I got going, it worked great. Overall, this is a solid edger/trencher for the price, and I would definitely recommend it for anyone wanting cleaner lawn edges without dealing with gas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
J
Verified Purchase
Jason
West Palm Beach, US
★★★★★ 5
Does the job!
Puts in the work! Knocked out my driveway no problem. Unsure about longevity but it’s great for a homeowner. Easy to assemble. Easy to use. Adjustment is nice along with the guide plate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
B
Verified Purchase
B. Colonna
New York, US
★★★★★ 4
Takes The Edge Off!
This is a decent product. If you are going to do a lot of edging, or want to do deep trenching to run conduit, etc. this is NOT the product you want. It is electric, so you are tethered to an outlet, and of course, the farther you go on extension cords, the less of the 12 amp juice you get. It also trenches to 1 1/2", which is OK, but not enough to dump conduit, etc. That said, this is a very good edger. Out of the box, it is minimal assembly. You connect the three pieces of the shaft, removing some edge tape from it, and inserting two metal bolts and plastic knobs, similar to most lawn mowers these days. Then you install the plastic handle with another bolt. That's it. For use, you have a lever which you pull up for edging and lower for trenching to adjust the group clearance. You also choose 1", 1/4", or 1 1/2" depth. Then you plug it in. There is a white line on top of the blade cover so you know where the blade is. You just pull the trigger to run the blade, or release the trigger to stop the blade. Be careful not to lose sight of your electric cord so you don't hit it! I edged along my driveway, about 50' on each side, as well as my front of my lawn, so another 85' along the lawn and the apron (both sides). That's over 350'. It cut through the grass and dirt easily. It struggled a couple of times, on some tough mounds of grass, but like any other tool, you don't force it when that happens, just back up and do that area again slowly. If you come too close to blacktop, Belgian block, stone, etc. you will see sparks so you will know. Just keep in mind, this is an edger. You will be left with the severed grass/sod to remove. In my case I was loooong overdue for a edging, so I spent a long time scraping the sod off the pavement with a shovel. I expect with more frequent ending, and now working with a cleaner edge, this will be less of an issue. Either way, that is not on the product, but the state of the lawn. The edger has 2 read wheels and one smaller front wheel so , although this is not like a big, gas-powered curb jumping unit, you have the option of attacking a curb edge from either the blade side or other side of the edger, so you can get real close to a Belgian block curb. I also did the edge where my grass meets my mulched flower bed, but that was more of a trimming than a edge removal. Overall, the Work edger did as good, or better, a job than my string trimmer, and I didn't have to stop every few minutes to rewrap string. Plus it trenched enough to give me a definitive edge, whereas the string edger just cuts into the grass, not a real trench.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2020

recommand products