SKU: 63496511077

FABP8 His Tag, Human

Sale price$168.75 Regular price$187.50
Save 10%

Pay in installments of $46.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP8 His Tag, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Fatty acid binding protein 8, P2, PMP2
Accession P02689
Amino Acid Sequence Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Expression System E.coli
Molecular Weight 18kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63496511077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
EM
Chelsea, US
★★★★★ 5
Warm, Sensual, Romantic
Format: Paperback
This is a warm, lush, and wonderfully written book. I loved how the romance played out and the richness of the world.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2025
G
GoddessLucyLou
Omaha, US
★★★★★ 5
Detailed world building
Format: Kindle, Format: Kindle
I was completely immersed in the world that Dani spun so well. The book is filled with details and beautiful descriptions. The tempo and flow of the book was easy to follow. The book follows a strong female business owner who has dealt with prejudices and discrimination. The love story that develops is beautiful. My favorite line in the book sums it up perfectly. “…she had forgotten, for a moment, what parts she had. She was simply a woman being made love to by another woman.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
K
Kindle Customer
Belleville, US
★★★★★ 5
Sweet and Spicy
Format: Kindle
I really enjoyed this. It is mushy and sweet and very spicy as well. I like how the MCs business is part of it and also the love interest's son. Interesting world building as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2025
C
Catherine Bowser
Draper, US
★★★★★ 4
What a spicy lovely tale of love
Format: Kindle
I receive an ARC copy and am leaving my thoughts voluntarily. I really liked all the other books in this series and it was so nice to see characters I loved again while being introduced to some new faces that I can to love just as much. And I love seeing that some development has occurred! It’s not vital to the story but still nice to see. The idea of a romance with one character being a single mom isn’t something I see too often. And it’s done so well here. There’s genuine interest in not only the mom but the child as well and becoming a true family, with all feelings considered. I adored seeing the interactions with Theo. And one character is also trans, with some societal pushback they have to struggle though, which makes life all the harder and the sweet scenes all the sweeter. The spice here is high. But the thing I love about all Dani’s books is the strong emphasis on consent. It’s not there as an afterthought, it is as important as aspect as the physical act! And I adore it. Anyone that argues consent can’t be sexy should read Dani’s books. The world building is woven into the plot with exploration of history, discussion of the “he said, she said” of historical events, and how knowing the truth is important. I loved seeing the characters uncover and process everything. That’s probably a huge trait of Dani’s books I adore—there’s room to breathe. They give you the space to really process which adds to the realism. These are character driven books and I love getting to know each one. Recommend this one and all the ones before it! Just make sure you can handle the spice and the nastiness of how cruel people can be because it pulls no punches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2024
C
Verified Purchase
Chris F
Grantham, US
★★★★★ 5
Five Stars
Format: Hardcover
Just another good piece to add to my collection. Awesome was excited to get it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2014

recommand products