SKU: 58624763982

Human CELSR3 Protein, His tag

Sale price$297.00 Regular price$330.00
Save 10%

Pay in installments of $82.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CELSR3 Protein, His tagProduct Specification Species Human Synonyms Cadherin EGF LAG seven pass G type receptor 3, Cadherin family member 11, Epidermal growth factor like protein 1 (EGF like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor like domains protein 2 (Multiple EGF like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2 Accession Q9NYQ7 Amino Acid Sequence Protein sequence (Q9NYQ7, Arg71 His180, with C His tag)

Product Specification


Species Human
Synonyms Cadherin EGF LAG seven-pass G-type receptor 3, Cadherin family member 11, Epidermal growth factor-like protein 1 (EGF-like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor-like domains protein 2 (Multiple EGF-like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2
Accession Q9NYQ7
Amino Acid Sequence

Protein sequence (Q9NYQ7, Arg71-His180, with C-His tag) REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Expression System HEK293
Molecular Weight Predicted MW: 13.3 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cadherin EGF LAG seven-pass G-type receptor 3 is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58624763982

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
Junior prom
Size: X-Large, Color: Christmas Green, Size: X-Large, Color: Christmas Green
I took a big chance and we won my son was so handsome. It was worth the money He said it was comfortable the material was soft not stiff And the quality was great He is 6ft X-Large fit perfectly. If you are going back and forth like a did stop, you are making the right choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
L
Verified Purchase
Lamar Brown
Chelsea, US
★★★★★ 5
Brothers funeral suit.
Size: X-Large, Color: Burgundy
Used this on my brother that just passed. He looked very very good. Love the fabric and colors
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
R
Verified Purchase
RickyD
Cuba, US
★★★★★ 5
Package
Size: X-Large, Color: Burgundy
Excellent fit and fast delivery!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
L
LT
Bozeman, US
★★★★★ 4
Great suit, but size up
Size: Large, Color: Black, Size: Large, Color: Black
This set comes with a jacket, pants, extra buttons, and a bow tie with an easy clip to remove it. The suit itself is really nice and I love the pattern, however, I thought I purchased a XXL, but seemed to have ordered a L instead. Not quite sure how that happened, but suffice to say, he could not fit the suit. He is normally an L in pants, so based on the fit, we would have needed to size up anyways. He couldn't fit his leg in the pants or his arm in the jacket. I automatically size up on items like this because you can take clothes in, but can't take them out if there is not enough cloth. The suit pants are not lined, but you can see that they did leave room for the legs to be let out. Perhaps if we have the pants let out, he would be able to wear the pants. The jacket is fully lined and it comes with two inside pockets, one can be buttoned. I cannot tell if the jacket has room for alterations, but I might have him fitted for it just to see. It comes with a slit on the back of the jacket, so it has that going for it from a quality standpoint. It does come folded so you have iron or dry clean it before wearing. The quality is good for the most part. There are some threads coming out of the bow tie, but that's all I seen that is less the good. I'm giving it four star based solo on it's look and feel. Of course, I can't comment on the fit. For around $80, I definitely think it's worth checking out for a school semi-formal or fancy dinner out. It might be a little lightweight for a higher end event. Did I say I love the pattern?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
M
Mohamed
Omaha, US
★★★★★ 5
Stylish look and great value for special occasions
Size: X-Large, Color: Blue, Size: X-Large, Color: Blue
This suit looks really good in person. The pattern adds a nice touch that makes it stand out without looking too flashy. It is a great option for events like weddings, parties, or prom where you want something a bit different from a basic suit. The fit is slim and modern, giving a clean and sharp look when worn. It feels comfortable enough for a few hours, and the overall shape looks more tailored than expected for the price. The jacket sits well, and the pants match nicely to complete the set. The material is lightweight and decent for occasional use. It does not feel like a premium suit, but it looks good and photographs well, which is what matters for events. The bow tie included is a nice extra and helps complete the outfit without needing to buy more pieces. It may need a quick steam or ironing out of the package to look its best. Also, checking the size chart is important to get the right fit. For the price, this is a very good value. You get a full outfit that looks stylish and put together without spending too much. Great option if you need something affordable for special occasions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026

recommand products