SKU: 54591549105

Rabbit IL21, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rabbit IL21, His tagProduct Specification Species Rabbit Amino Acid Sequence Protein sequence (XP_008266192. 1, His18 Arg150, with C His tag) HKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDVQKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYSYEKKNLKEFLERLKSLIQKMIHQHLLEHLR Expression System HEK293 Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Rabbit
Amino Acid Sequence

Protein sequence (XP_008266192.1, His18-Arg150, with C-His tag) HKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDVQKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYSYEKKNLKEFLERLKSLIQKMIHQHLLEHLR

Expression System HEK293
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 21 (IL-21) is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. IL-21 is noted to have anti-tumour effects through continued and increased CD8+ cell response to achieve enduring tumor immunity. IL-21 may contribute to the mechanism by which CD4+ T helper cells orchestrate the immune system response to viral infections. In HIV infected subjects, IL-21 has been reported to critically improve the HIV-specific cytotoxic T cell responses and NK cell functions. IL-21 was approved for Phase 1 clinical trials in metastatic melanoma (MM) and renal cell carcinoma (RCC) patients. IL-21 proceeded to Phase 2 clinical trials where it was administered alone or coupled with drugs as sorafinib and rituximab.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54591549105

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tony
West Palm Beach, US
★★★★★ 5
This knife set offers great value for the price
Size: 6 Pcs, Color: Stainless Steel
I recently purchased this knife set, and overall, it has been a solid addition to my kitchen. Right out of the box, the knives felt well-balanced and comfortable to hold, which made a noticeable difference during meal prep. The handles provide a secure grip, even when my hands are slightly wet, and the weight distribution gives a sense of control that’s especially helpful for more precise cuts. In terms of performance, the blades are impressively sharp and handle a variety of tasks with ease—from slicing vegetables to cutting through tougher meats. I’ve used them regularly for a few weeks now, and they’ve maintained their edge better than I expected. That said, like most knives, they do benefit from occasional honing to keep them at peak performance. The set itself is versatile, covering all the essentials you’d need in a typical kitchen. The included block (if applicable) keeps everything organized and easily accessible, while also adding a clean, modern look to the countertop. One minor drawback is that the knives require careful hand washing and drying to prevent any potential rusting or wear over time. They’re not the kind of set you’d want to toss into the dishwasher if you want them to last. Overall, this knife set offers great value for the price. It’s a reliable option for both everyday cooking and more involved meal prep, especially for home cooks looking to upgrade their kitchen tools without overspending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
S
Verified Purchase
Sophia Yeh
Los Angeles, US
★★★★★ 3
Affordable knives, horrible knife block
Size: 14 Pcs, Color: Red, Size: 14 Pcs, Color: Red
Knives are sharp and aren’t super rust resistant, but they get the job done. The knife block however, is horrible. It wasn’t sanded down or polished, so wood shavings can get into the grooves of the knife whenever you insert or take out the knives from the block.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
T
Verified Purchase
THOMAS F COURTNEY
Natrona Heights, US
★★★★★ 5
Moss & Stone Knives Sharpness
Size: 14 Pcs, Color: Black
Knives cut great. Nice and sharp.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
A
Verified Purchase
Arlet
Los Angeles, US
★★★★★ 5
Si quieres algo sencillo económico está es tu mejor opción
Size: 14 Pcs, Color: Black, Size: 14 Pcs, Color: Black
Necesito algo económico y básico para mi nuevo hogar y esta es una excelente opción
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
C
Verified Purchase
Clary Elizabeth Domínguez lebron
Charlottesville, US
★★★★★ 5
Cuchillos
Size: 14 Pcs, Color: Black
10/10 igual que la imagen y la calidad súper buena
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products