SKU: 54325598075

FABP6 His Tag, Human

Sale price$193.50 Regular price$215.00
Save 10%

Pay in installments of $53.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54325598075

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brian P
Charlottesville, US
★★★★★ 5
Cariloha pillow cover replacement
Color: White, Size: Queen
I have a queen size Cariloha resort pillow and the zipper on the cover broke. This replacement is SPOT on and fit perfect. Material feels comparable to original very pleased.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
M
Mika Meeko
Bozeman, US
★★★★★ 5
The fabric feels soft and noticeably comfortable against the skin
Color: White, Size: Queen
This is a zippered pillow protector made from a bamboo/polyester blend with a quilted surface. I’ve been using it for a few months on a standard queen pillow, including regular washing and everyday use. It’s also been exposed to dog hair, which I’ve been able to manage by vacuuming the surface. Pros The fabric feels soft and noticeably comfortable against the skin Breathable design helps keep the pillow from feeling overly warm Quilted texture adds a bit of cushioning without changing the pillow’s shape Zipper closure keeps the pillow fully enclosed and secure Holds up well after multiple washes Vacuuming the surface works well for removing pet hair Cons White fabric shows dirt and hair more easily between washes Slightly thicker than a basic pillowcase, which may not suit everyone Bamboo blend feel is smooth but not identical to 100% natural fabrics Bottom line: For me, this has been a comfortable, low-maintenance pillow protector that holds up well over time, especially useful if you want something breathable that can handle regular cleaning and pet hair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
R
Verified Purchase
r c.
Cuba, US
★★★★★ 4
Say goodbye to neck pain
Color: White, Size: Queen
This is a very good product but it takes some time to adjust removable stuffing to accommodate individual sleeping patterns.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
D
Dale Kim
Waukegan, US
★★★★★ 5
Soft and comfortable cooling pillowcase that gets the job done!
Color: White, Size: Queen, Color: White, Size: Queen
I got this quilted bamboo pillow protector (queen size) because I wanted a cleaner, cooler layer between my pillow and pillowcase since I’m always hot. This has been a great solution for that. The fabric feels soft and smooth, and it doesn’t make that crinkly noise some cooling pillowcases do. I’m a warm sleeper and the “cooling” aspect feels more like breathable than icy-cold, but it definitely sleeps more comfortably than the thick polyester protectors I’ve used in the past. The light quilting adds a little cushion without making my pillow feel bulky or changing the loft much. I like the fact that if you use a memory foam fill pillow you can add or remove some of the filling to make the pillow as firm or mushy as you want. This is especially helpful for people that are side sleepers vs people that need more neck support. The zipper is a big plus. Just be careful when zipping it open and closed as these are usually the first point of failure for pillowcases in my experience. It closes fully and keeps the protector snug so it doesn’t shift around inside the pillowcase, and it gives me peace of mind for sweat / oils and everyday wear. I’ve washed it and it came out fine with no weird shrinking, and the stitching still looks clean. For the price, it feels like good value if you’re trying to extend the life of a nicer pillow while keeping the sleep surface soft and breathable. It’s one of those small upgrades you don’t think about much once it’s on, which is kind of the point. It just works and helps me sleep more comfortably.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
C
Codescriber
Lexington, US
★★★★★ 5
Soft and cooling
Color: White, Size: King, Color: White, Size: King
This pillow cover is great! Well made. Not too thin. Fits my queen pillow like a glove. Came out of the washing machine still looking brand new, with no zipper issues, which can happen with lower quality covers. Zero complaints.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026

recommand products