SKU: 53699894690

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53699894690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nura
Lexington, US
★★★★★ 5
Excellent Protection for Active Kids
The Coppertone Kids Sunscreen Lotion, SPF 70 has become a must-have in our outdoor routine. This sunscreen provides outstanding protection for my child’s skin, and I trust it to keep them safe during long hours outside. Reliable Sun Protection for Kids This sunscreen offers excellent SPF 70 protection, which is ideal for active kids who love being outdoors. I appreciate that it’s designed specifically for children, and it holds up well during activities, even with a lot of sweating or water play. Slightly Thick, but Worth the Effort The only small drawback is that it’s a bit thick, making it a little difficult to squeeze out of the bottle. However, once applied, it absorbs well and doesn’t leave a sticky residue, so it’s worth the minor inconvenience. Final Thoughts Overall, Coppertone Kids Sunscreen Lotion is an effective, reliable option for parents looking to keep their children protected in the sun. Despite the thicker consistency, it’s easy to apply and provides lasting coverage—highly recommended for peace of mind outdoors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2024
V
Verified Purchase
Vanessa D.
Louisville, US
★★★★★ 5
Love this product!
This sunscreen is heavy duty, I use it on my boys when we go to beach (They love to spend hours and hours under the blistering sun) and it out performs other brands and has longer protection than their 50 SPF product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
T
Verified Purchase
The Crimson Clover
Phoenix, US
★★★★★ 4
Sun Safe and Satisfied
Living in Arizona, where the sun reigns supreme, finding a reliable sunscreen for my daughter has been paramount. Our spring and summer are filled with swimming lessons, poolside gatherings, and outdoor adventures. In this sun-drenched setting, Coppertone SPF 70 Sunscreen for Kids has become our go-to sun protection. The standout feature for me is its thick consistency. It’s a parent’s little helper, allowing clear visibility of where the sunscreen is applied to ensure no spot is missed. And the results speak for themselves – my daughter hasn't had a sunburn since we started using it. While she doesn’t have the fairest skin and tends to tan rather than burn, the effectiveness of this sunscreen has been impressive. I’ve even used it on my own skin, particularly on my shoulders, and I'm happy to report no sunburns there either. It’s reassuring to have a product that I can trust for both myself and my child. However, I’m aware of the growing concerns regarding certain sunscreen ingredients and their potential health implications. Coppertone SPF 70 contains a mix of chemical sunscreens like Avobenzone, Homosalate, and Oxybenzone. These ingredients have raised questions in recent years. Some studies suggest that chemical sunscreens can be absorbed through the skin and into the bloodstream, leading to potential health risks. Oxybenzone has been under scrutiny for its potential effects on coral reefs and marine life, as well as concerns about hormonal disruption in humans. While these ingredients have been effective in preventing sunburns for us, I understand the importance of making informed choices, especially when it comes to health and wellness. As with any health-related product, I encourage others to research and decide what’s best for their family, considering both the effectiveness of sun protection and the potential impacts of ingredients. In conclusion, Coppertone SPF 70 has been a reliable ally in our family's fight against sunburns. It's a product that offers peace of mind when it comes to sun protection, but mindful consideration of its ingredients is advised for those who are concerned about the broader implications of chemical sunscreens.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2024
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 5
Amazing how fast it goes on without the white look!
This stuff is amazing!! I wear baby sunscreen because I rub my eyes a lot, but most of it takes forever to rub in and not look white. This rubs in immediately like any other sunscreen, and it doesn’t burn my eyes at all, not even when I scratch my face and then rub my eyes. So it’s great for small children too, not just 75 yr old ones!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
J
Verified Purchase
Jessica
Cuba, US
★★★★★ 5
Used for years
I have used this sunscreen since my kids were toddlers. I don’t find it sticky and it turns clear pretty fast. I don’t typically need to reapply on them more than once.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026

recommand products