Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human IL-10, His TagProduct Specification Species Human Accession P22301 Amino Acid Sequence SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 19. 6 kDa (Reducing) Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4
Product Specification
| Species | Human |
| Accession | P22301 |
| Amino Acid Sequence | SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 19.6 kDa (Reducing) |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles. |
Background
IL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy