SKU: 51327664609

Human CD90, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD90, hFc tagProduct Specification Species Human Synonyms CDw90, Thy 1 antigen Accession P04216 Amino Acid Sequence Protein sequence(P04216, Gln20 Cys130, with C hFc)

Product Specification


Species Human
Synonyms CDw90, Thy-1 antigen
Accession P04216
Amino Acid Sequence

Protein sequence(P04216, Gln20-Cys130, with C-hFc) QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:38.6 kDa Actual:54 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 led to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51327664609

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mundy55
Lake Worth, US
★★★★★ 5
Great look and very powerful - consider what your wanting to froth/mix - may be too powerful
Color: Lux White, Size: Rechargeable Z1 Motor Max
It's a great frother - but more for large drinks. Very powerful, even on the low speed. I returned it because I want something to mix my collagen and creamer in my coffee. The first time I turned it on it shot half the coffee out of the cup - very powerful. It has a great look, sleek and fits easy in the hand - but for what I needed, two powerful. It would have been nice to have a fully adjustable speed wand like my replaceable battery powered frother.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
I
Verified Purchase
investor
West Palm Beach, US
★★★★★ 5
Powerful, rechargeable battery, easy to use & clean
Color: Lux Absolute Silver, Size: Rechargeable Z1 Motor Max
2 speeds, easy to change back and forth to different speeds with one click , easily blends 1/4 cup protein powder in 12 oz milk on low speed. Easy to clean: Stick blending wand in tall glass with warm water + dish soap, turn on low speed to clean easily (don’t stick the part that holds the battery in glass). Also of note, chosen by Americas Test Kitchen as best milk frother but I use it to make protein shakes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
Q
Verified Purchase
QuietLife33
Natrona Heights, US
★★★★★ 5
Works great on bullet coffee!!
Color: Lux Alpha Black, Size: Rechargeable Z1 Motor Max
I am really pleased with this frother! Frothers I have used in the past didn’t mix my decaf coffee, 2% milk, and MCT oil as thoroughly as I like (oil and coffee separated). This frother blends everything AND I get a nice layer of frothy milk on top!!! Charge lasts a long and the froth can be submerged all the way up to the button!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
P
Peace
Dallas, US
★★★★★ 5
Compact, lightweight, and useful milk frother.
I ordered the Electric Handheld Milk Frother in the Starlight Black color. I don’t drink coffee, let alone fancy coffees where I would normally need a milk frother, so I bought this for one reason and one reason only: scrambled eggs. I make a ton of scrambled eggs. Now, I can whisk eggs by hand just as well as the next person, and I’m not entirely convinced a frother whips them better than I can, but regular whisks take up a ton of room in my drawers and this does not. I really just wanted something compact that could whip my eggs into a nice frothy consistency without taking up much space. Even better, this one looks nice enough to just leave sitting on the counter where I can grab it easily. I will note that although I can hand whisk easily enough, there are many people who cannot due to arthritis or other issues, and this whisk is a brilliant tool for them. If you actually want to use a frother for other things, this one does perform very well. It has three speeds and comes with three different attachments: a spring whisk for latte and cappuccino foam, a balloon whisk for eggs and cream, and a hook whisk for blending protein powders or mixes without lumps. I actually ended up using the hook whisk while making pot roast. I mixed the seasoning packet with water using this frother and it blended everything perfectly with no lumps at all. The frother itself is lightweight, pretty quiet, and very easy to clean. The attachments detach easily and just need a quick rinse under soapy water. It also comes with a magnetic wireless charging dock that uses the included USB-C cable. The docking connection is simple and secure, and charging has been completely hassle-free so far. The LED display shows battery levels at 25%, 50%, 75%, and 100%, which is useful for knowing when it needs to be charged. Overall, it’s a simple, convenient kitchen gadget that does exactly what I wanted it to do and I am quite satisfied with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
P
Pawslife
New York, US
★★★★★ 5
Works great and easy to use
Kitchen gadgets have a way of accumulating. You buy them with good intentions, use them twice, and then they live in a drawer forever. This milk frother is not that. It's one of those rare small appliances that earns its spot on the counter every single morning. The wireless charging is the feature that sets this apart from every other handheld frother on the market. No fumbling with a charging cable, no little dock that takes up extra space — just set it down and it charges. It sounds like a small thing until you've used it, and then it feels like the obvious way every handheld kitchen tool should work. The fact that it charges quickly means you're never waiting around or reaching for it only to find it dead. Three speed settings give you real control over the result. Low for gentle mixing, high for a proper thick foam that holds up in a latte or cappuccino the way it should. The stainless steel whisk feels durable and substantial, not like something that's going to bend or corrode after a few months of daily use. The whole thing is well-made in a way you notice immediately, solid, balanced, and built to last. The Starlight Black finish looks sharp, too. It's sleek enough to leave out without cluttering your kitchen aesthetic, which matters when you're using something every day. If you make lattes or cappuccinos at home and you're still shaking a jar of milk or settling for flat foam, this is the upgrade you didn't know you needed. Easy to use, quick to charge, and genuinely well crafted.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products