SKU: 48205645754

Rhesus macaque TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)

Product Specification


Species Rhesus macaque
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B
Accession F6S8F9
Amino Acid Sequence

Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48205645754

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Apiffanie George
Louisville, US
★★★★★ 5
Great product, quality colors and vibrant prints
Color: 1BK/1C/1Y/1M
Best Sublimation Ink I have found so far. Great size bottles for the price you pay. Lasts a long time and the colors print great and when you press the print the colors come out BEAUTIFUL and VIBRANT! Dries quickly after printing so no worries on smudging but even after sitting over a month on the paper still presses like you printed it that day!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
B
Verified Purchase
Bel Anne Craft Studio
Los Angeles, US
★★★★★ 5
Consistent, Vibrant Results That Match My Designs Perfectly
Color: 1BK/1C/1Y/1M
I’ve been consistently purchasing this Hiipoo sublimation ink for my sublimation printers, and I’ve been extremely pleased with the results. The print quality is excellent, with vibrant colors and clean transfers every time. What I really appreciate is how true the final product turns out compared to my original designs. The colors stay accurate, and the finished results look exactly the way I intended, which is very important for my projects and products. This ink has been reliable and consistent, and I will definitely continue using it for my sublimation work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Perfect to the job
Color: 1BK/1C/1Y/1M
No issues with this ink. Used it to turn a printer into sublimation printing and the ink is perfect and easy to fill.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
M
Verified Purchase
Monique Rodriguez
Charlottesville, US
★★★★★ 5
Great for sublimation
Color: 1BK/1C/1Y/1M
Great for sublimation. Colors r vibrant and dries fast. Easy to install and is compatible with my epson peinter
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
A
Verified Purchase
Angela
Chelsea, US
★★★★★ 5
Great quality, Great price
Color: 1BK/1C/1Y/1M
Excellent transfer and image quality. It really does work in an Epson Eco tank, as long as you never fill it with the Epson ink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026

recommand products