SKU: 44075796855

Human IL-17A, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 27 - Aug 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-17A, His tagProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated antigen 8 (CTLA 8) Accession Q16552 Amino Acid Sequence Protein sequence(Q16552, Gly24 Ala155, with C 10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8kDa Actual: 17, 20kDa Purity 95% by SDS PAGE Endotoxin

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8)
Accession Q16552
Amino Acid Sequence

Protein sequence(Q16552, Gly24-Ala155, with C-10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8kDa Actual:17, 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 44075796855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sheri Lynn
Draper, US
★★★★★ 5
Excellent
Size: 50 Count
Amazon Basics Ultra Paper Bowls, 20 oz, are a practical choice for anyone needing disposable bowls for everyday use or special occasions. Whether you're hosting a casual get-together, packing lunches, or simply want an easy cleanup option after a meal, these bowls offer a convenient solution. They are sturdy enough to hold both hot and cold foods without bending or leaking, which makes them versatile for soups, salads, snacks, and more. One of the standout features is their generous 20-ounce capacity, providing ample space for a satisfying portion. The bowls have a simple, clean design that fits well in any setting, from picnics to office lunches. Users appreciate their durability and the fact that they are lightweight and easy to stack, saving storage space. Additionally, being disposable, they eliminate the hassle of washing up, which is always a plus for busy households or events. Overall, these Amazon Basics paper bowls deliver solid performance at a budget-friendly price. They strike a nice balance between functionality and convenience, making them a reliable choice for anyone looking to simplify mealtime cleanup. If you want disposable bowls that handle a variety of foods without fuss, these are definitely worth considering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
G
Verified Purchase
Gabriella
Fort Morgan, US
★★★★★ 5
These paper bowls are actually really sturdy for disposable bowls!
Size: 50 Count, Size: 50 Count
These paper bowls are actually really sturdy for disposable bowls! We use them for everything from cereal and soup to quick toddler meals, and they hold up well without getting soggy or flimsy. I also love that they’re microwave safe, which makes busy days a little easier. Great quality for the price and always handy to keep stocked at home!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
A
Verified Purchase
Amber
Massapequa, US
★★★★★ 5
My paper bowls of choice.
Size: 50 Count
I have been a return buyer of these bowls and amazon basics plates, as they are sturdy and well made, even for liquids. I think there is a generous quantity for the price. I use for my to go meals on the way to work, so I dont have my whole kitchen accumulating in my car. They are good sized and you can fit a decent serving. Will keep buying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
L
Verified Purchase
LindaM
Port Orchard, US
★★★★★ 5
Sturdy paper bowls, economical quantity purchase
Size: 300 Count
I previously bought 50 (?) of the paper plates to check the quality and see how well they hold up before making quantity purchases of other paper products. The bowls hold up well though I use them primarily for cut up avocados, sliced tomatoes, cole slaw, etc. I have used them in the microwave under 15 seconds to reheat toasted English muffins with marmalade with no problem. I use Pyrex glass bowls in the microwave for veggies and soups, so I am unable to speak on how well the bowls hold up with hot foods in the microwave. I resisted buying and using paper bowls and plates for a long time; however, with my 80th birthday fast approaching, the fewer dishes I have to wash means less time standing on my feet. I am an experienced shopper, and these quality paper products bought in bulk are the best buy I have found. I recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
J
Verified Purchase
Joy
Whiting, US
★★★★★ 4
My go to.
Size: 50 Count
Nice. Sturdy and good thickness. Nice size. Bought these along with smaller. Leak proof.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products