SKU: 4376509055

Human NF-H(Neurofilament heavy polypeptide) , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession P12036
Amino Acid Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.5kDa Actual:11-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4376509055

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Emma
Phoenix, US
★★★★★ 5
Great! Smells good, and subtle sparkle!
Color: Gold, Size: 3.38 Fl Oz (Pack of 1)
Smells so good !!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
Emily
Belleville, US
★★★★★ 4
Actual glitter instead of highlighter
Color: Gold, Size: 3.38 Fl Oz (Pack of 1)
I was looking for a glow body oil that had actual pieces of glitter in it, instead of just a body highlighter (like many of the other market glow oils) and this is exactly what I was looking for. It smells delicious and is very moisturizing. It does feel like an oil, but it is lightweight. I have the sol de janiero glow oil and the main differences are the pieces of glitter vs the highlighting effect. Its not an over powering amount of glitter but just enough that if the light hits you, you can tell there is a shine
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
D
Verified Purchase
Deshanti Montgomery
Battle Creek, US
★★★★★ 5
Love
Color: Gold, Size: 3.38 Fl Oz (Pack of 1)
I love how this smells, looks and feel
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
J
Verified Purchase
Jenn
Chelsea, US
★★★★★ 3
Glass bottle
Color: Gold, Size: 3.38 Fl Oz (Pack of 1)
Smells nice, not the shimmer I was looking for. It wasn’t super glittery like another brand I had. Also it’s in a glass bottle. So I didn’t feel comfortable packing it on my trip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
E
Verified Purchase
Ena B
Chelsea, US
★★★★★ 5
Shimmer body oil
Color: Gold, Size: 3.38 Fl Oz (Pack of 1)
Nice Product Lite and a little bit of shimmer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026

recommand products