SKU: 39699383268

Human TL1A/TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 Amino Acid Sequence Protein sequence (O95150, Leu72 Leu251, with C His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150
Amino Acid Sequence

Protein sequence (O95150, Leu72-Leu251, with C-His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 22, 25, 28 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39699383268

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Randy Groves
Dallas, US
★★★★★ 1
Difficult to stay on
Size: 1 Count (Pack of 6)
Won't stay on your face. Only a few patches come in the box for a few days. Price sounds good until you realize the quantity isn't much. I did not notice any difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
C
Verified Purchase
Concerned Citizen
Port Orchard, US
★★★★★ 5
Great product you should try
Size: 1 Count (Pack of 6)
I love these patches, have been my favorite go to since they came out. I think they do better than any other patch, spray, or gel I have used so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
E
Verified Purchase
Elizabeth J.
Port Orchard, US
★★★★★ 5
It works!
Size: 1 Count (Pack of 6)
Got this for my husband and it really works. He left it on while he was drinking his morning coffee. He's 1/2 Asian and has normal puffy eyes from dusk to dawn. It's just been been one day but the results were truly amazing. Puffiness 75% go e in one eye and 50% in the other. Im impressed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 2
Disappointed
Size: 1 Count (Pack of 6)
After six applications, I do not see any difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
A
Andy
Battle Creek, US
★★★★★ 5
A have a Canadian Copy
Format: Kindle
This book provides a profound yet accessible exploration of Jesus Christ's teachings, offering clear and practical insights into the core commandments. Through compassionate explanations, it makes these timeless principles relatable and actionable for modern readers. The guidance encourages not just understanding the commandments but living them out daily, fostering personal transformation and a deeper spiritual connection. A particularly meaningful aspect is the concluding section, where readers are invited to reach out to the authors directly. This thoughtful gesture adds a personal touch, emphasizing their genuine interest in building a connection with their audience. Combining spiritual wisdom, practical application, and heartfelt engagement, this book is a valuable resource for anyone looking to deepen their faith and embrace a life guided by love and purpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2025

recommand products