SKU: 39690486587

CTLA-4 His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CTLA-4 His Tag Protein, HumanProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated protein 4 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 20 27kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated protein 4
Accession P16410
Amino Acid Sequence Ala37 - Phe162, with C-terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 20-27kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39690486587

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Leslie
Phoenix, US
★★★★★ 5
Good, inexpensive espresso machine but NEED TO READ THE INSTRUCTIONS BEFORE USING.
Color: Silver, Color: Silver
I have no financial benefit from this review. After reading negative/positive reviews for this Neretva Espresso Coffee Machine - 1/2 Cups/Frother, I decided to purchase. Although I've only had it since 8/27/25 (writing this review 8/31), I am convinced the bad reviews are because the buyers didn't read the instructions. This was obvious to me because of complaints about the "error messages" and water exiting the steam wand. I was not familiar with espresso machines, and am new at wanting to learn how to brew espresso and other coffee beverages, so had to also look at You Tube videos after reading the instruction booklet that comes with the machine. After experimenting since the machine was delivered, today I was able to make a Flat White. I had several failures using the frother/steam wand. So, there was a learning curve for me. Although I have only been using this machine for 5 days, I am very pleased with my purchase and recommend for anyone who doesn't want to spend more than $100. I would give the warming tray a "D", but everything else an "A". Instead of the warming tray, I pour boiling water in my cup (and empty prior to brewing the espresso), while I'm getting everything ready. The suction cups are very strong, so I decided to put the machine on a small, hard placemat, as it's much easier to move the placemat around than to unstick the suction cups from the counter top to move it around. Also, I needed to purchase a metal pitcher to steam/froth the milk per You Tube videos. Because this is an inexpensive machine and because Neretva does not have a brick/mortar I can call directly, I purchased a 4-yr. warranty. I learned through the internet Neretva has been around since 2008, but it's a global, e-commerce, brand that manufactures and sells a range of small, electric kitchen appliances, mainly through Amazon and Walmart, to consumers who want convenient, affordable appliances for making coffee, bread and a few other foods at home. I have no clue as a consumer how to contact them; hence, the warranty. 9/10/25 Update: I still recommend this espresso machine, but wanted to offer a tip due to what happened to me this morning making my daily espresso. I set everything up to just plug in the machine and press the button before I left for about an hour to do my daily laps in the pool. When I came home, I plugged in the machine and pressed the power button while I took a quick shower. Ten minutes later I was ready for my espresso so pushed the 2 shot button, waited and during what I call the countdown, nothing happened. I did this again, and no espresso came out. Reviewed the Trouble Shooting page. Quickly I realized that the water tank was empty, went through the process again with a full water tank, but the machine did not produce any espresso. Then I removed the Portafilter (which was in correctly) and saw a few coffee grounds on the rim of the Portsfilter (which I hadn't noticed when I got everything ready). I thought "Surely a few grounds wouldn't prevent the machine from working?", but I brushed off the grounds with a very small paint brush I use for this purpose, put the Portafilter into position and VOILA, got my cup of espresso. One might not want a machine that is so sensitive. Okay; I get it. Then spend more money. For me, I'd rather discover the quirks. Just thought this info might be helpful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2025
Z
Verified Purchase
Zoraida
Alexandria, US
★★★★★ 5
Affordable and reliable!
Color: Silver
This is an awesome Espresso machine!!!! Small footprint, and frothing has no match!!! I really enjoy making coffee with it and I strongly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Verified Purchase
Jason M. Massaro
Houston, US
★★★★★ 5
Very impressed, perfect shot of espresso with exceptional creme, compact, excellent value.
Color: A-Silver, Color: A-Silver
I am **very** impressed with this sleek, espresso machine. The Casabrews 5418 PRO is phenomenal and such a great value. The pros and cons are very well set out by Neo Pam in her review of December 8, 2025. The machine heats up almost instantaneously and brews a perfect shot and double shot of espresso. It is very easy to use and clean and the instructions are helpful. I really like the compact size. Note that I drink almost exclusively espresso so I make no comment on the steamer other than to say I tested it and it produces copious amounts of very hot steam. Be careful in pushing the wand back--it gets very hot. This was a great purchase and I enjoy it every morning!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
N
Verified Purchase
Nidan Jutsu
Draper, US
★★★★★ 5
Fast and Easy! Great Taste!
Color: A-Silver
This is my first espresso machine. The first thing you should know is to select the right beans -- especially if you choose the bottomless portafilter (optional, but recommended.) I bought a bag of Starbucks non-espresso dark roast beans, and it couldn't get to the espresso pressure in the bottomless filter; those beans are too oily for espresso. Their dark roast espresso beans work great, though. Here's why this is the best Casabrews machine (in my opinion.) The "Flash heat" tech is ready to brew FIVE SECONDS after hitting the power button (feels more like 3.) There are machines that take anywhere from 30 seconds to about 20 minutes to heat up. I don't know about you, but I don't like waiting. This same tech is ready to froth milk 5 seconds after brewing. You can't froth at the same time, but you're already potentially on your daily limit of caffeine while your "friends" are still waiting for their clunky machines with double boilers to warm up..! I've used mine daily since late November. If you have hard water, you will have to descale more often (I've done it once so far.) In my case, I use a Kangen filter on the 11.5 (alkaline) setting. This causes faster buildup, but the taste is worth it, and I've always used 11.5 pH for all coffee--drip and Keurig. I use 17.5g of those Starbucks beans -- different beans may require different amounts. If you overfill the basket, you will get more steam and dripping. If you underfill it, you won't hit espresso pressure and it will taste weak and sour due to underextraction. I prefer tending toward overextraction. This could cause some bitterness, but that's easily-fixed by adding a few pinches of salt (I use Himalayan Sea Salt) or some almond milk. The punch and complexity are worth it, though -- it's the SOUL of the beans! ⚡😍🤩💪🏼 I've also used preground espresso, but it won't be quite as strong. That works fine with the pressurized double basket that comes with this machine -- but it won't reach pressure with the bottomless basket. The long-ground grains have lost their potency. I drink this if it's already early evening or later--so I could actually SLEEP! Two things you'll want to get right away are a WDT tool (a bunch of needles like a long comb) and a "knock box" (where you tap the filter to remove the leftover coffee puck.) I 3D-printed a knockbox from Thingiverse.com Make sure you select enough infill and 4 walls because it'll have to take a lot of abuse. It also helps to have a dosing funnel (also 3D-printed from there.) Any concerns about food grade stuff is addressed by either buying PET-G food grade filament or wet-sanding (which I opted for.) The WDT tool breaks up the coffee clumps, and you'll want to stir it down and into the arcs of the filter to prevent sputtering, uneven flow, and bad espresso. I also have a 3D-printed distributor--but many consider it unnecessary. I like it because it helps to center the grinds and then I tamp it down (I got an aftermarket tamper--one that has ridges; it works better than the flat ones.) I have a flat metal tamper, too. I just don't use it. Making a double takes about 5 minutes--starting from grinding beans, weighing, transferring, stirring, tamping, putting on the included puck screen and attaching the portafilter. After that, you just press the button. I always get 3 streams that consolidate into one, and good crema (a bit of foam.) I use a digital Etek scale (~ $10.) On scale use... My Etek can measure volume. But there are TWO settings. One is for milk (slightly different density) and one is for water. The one for water is approximately the same as the gram unit setting--as water is 1 gram per milliliter. Make sure if you are leaving it on the milliliter setting that you are using the water one. It has a drop icon. The milk setting has a cup with an "M" on it. You will put too much coffee in if you try to measure it with the milk setting. I found that out recently, as I was not aware of the separate setting for milk. So LIVE and LEARN! 🤓📈📊 If the machine gets accumulated mineral deposits, I take a straightened paper clip and carefully (VERY) insert into the hole in the mounting plate. I then run 2-3 doubles without the portafilter. If it gets more far-gone, I use citric acid (1 tablespoon per liter of water.) You could buy some descaling powder from a dollar store, but I think citric acid is more economical. I use it on my Kangen machine which is why I had it. You will then want to run a few cycles of doubles through to get rid of any aftertaste. You might be tempted to use vinegar and water. I used that on my Keurig and I had to run probably 6 or more cycles to get the vinegar taste out; I don't recommend it! Make sure you run some hot water through the frothing tube after each use -- and wipe it down to remove the milk before it gets too solidified. This is done by turning the dial all the way back to the left, having the machine on, and then turning it all the way to the right. After you see the flow is constant (not sputtering or uneven--I watch for about 5 seconds), turn the dial back to the far-left. That's it! This machine has changed my morning routine. I eat grits and a fried egg with it so I don't bounce off into the stratosphere on a caffeine high. The taste is quite good. I very rarely drink drip coffee (or even use it or the Keurig for coffee) since having this resource. Being away from home is hard, because it's hard to find good espresso -- especially at those licensed "Starbucks." Those are the ones that just pay to use their materials, but are not the genuine deal. Let me know how yours works out, how it tastes, and if you have any questions! 💯 Note: I made the video before I started using other tools mentioned, above.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
E
Verified Purchase
Elizabeth C
Whiting, US
★★★★★ 5
A must buy for espresso lovers and limited counterspace
Color: Black
If you want an espresso machine but don’t want to go though the entire massive machines this is the perfect beginning and even moderate espresso maker for you! So much you can do with it, makes a great solid shot of espresso. No concerns so far and fast and easy to learn steps. Recommending this to all our friends and family that are interested
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products