SKU: 33953486449

SLAMF7/CRACC/CD319 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SLAMF7/CRACC/CD319 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP 12 Accession Q9NQ25 Amino Acid Sequence Ser23 Met226, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP-12
Accession Q9NQ25
Amino Acid Sequence

Ser23-Met226, with C-terminal Human IgG1 Fc SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-72kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799.

2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002.

3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678.

4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305.

Background

SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33953486449

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David Mapes
New York, US
★★★★★ 3
The book itself is good. The content may be awkward or detailed in ...
Format: Paperback
The book itself is good. The content may be awkward or detailed in a way that makes reading tedious and a bit less enjoyable than what likw.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2016
B
Verified Purchase
B.King
New York, US
★★★★★ 5
Nursing school book that helps
Format: Paperback
I use this book for nursing school :0. The book covers a broad range of topics including cardiovascular diseases, respiratory conditions, diabetes, mental health, and much more. Each chapter is written by experts in the field, providing a high level of expertise and insight into best practices for managing various medical conditions. One of the things I appreciate about this book is the clear and concise writing style. The guidelines are presented in a format that is easy to understand and follow, making it an ideal resource for busy practitioners. Additionally, the authors have included helpful algorithms and decision trees to aid in the management of complex cases. Another strength of this book is the emphasis on evidence-based medicine. The guidelines are based on the latest research and are regularly updated to reflect new developments in the field. This ensures that healthcare professionals can provide the most effective and appropriate care for their patients. Overall, I highly recommend Clinical Guidelines in Primary Care for healthcare professionals working in primary care settings. It is a comprehensive and practical guide that provides evidence-based recommendations for the diagnosis and management of a wide range of medical conditions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2023
C
Verified Purchase
clarisse
Massapequa, US
★★★★★ 5
Great Resource
Format: Paperback
As a resource for NP school (and even after, I'm sure), this book is fantastic. I recommend it to anyone asking if it's worth it. I, however, refer them to a different site than Amazon as it is cheaper straight from the publisher. Significantly so. A hundred dollars difference doesn't quite justify the next day or 2-day delivery.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2025
V
Verified Purchase
Val Mac
Grantham, US
★★★★★ 5
So good for soap notes!
Format: Paperback
I wish I could have gotten this sooner when we had to write soap notes. It explains the illness, symptoms, tests, treatments, referrals and follow ups. I got it used and it came in great condition. Would definitely buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2024
T
Verified Purchase
Taylor
Carnegie, US
★★★★★ 5
Bible!
Format: Paperback
This book has been my life line with school. Freaking amazing and worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2024

recommand products