Pay in installments of $27.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 30 - Aug 4
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered
Product Specification
| Species | Human papillomavirus type 16 |
| Accession | P03129 |
| Amino Acid Sequence | Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 11.0 kDa Observed MW: 17 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy