SKU: 33621356056

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33621356056

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Marco L.
Belleville, US
★★★★★ 5
Best replacement option for 2025 Tesla Model Y Performance
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Outstanding replacement option for 2025 Tesla Model Y Performance (Pre-Juniper), so much smoother than the OEM wipers. Very easy to replace. They seem very durable after testing on all wiper settings. Definitely keep the windshield clearer without streaks. Seem to also have more stability on mounting compared to OEM option. 15/10 replacement for the cost, can’t beat it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
M
Verified Purchase
mfair
Port Orchard, US
★★★★★ 5
Great replacement set of wiper blades for 2024 CR-V! Work great & easy replacement!
Size: 24"+19"+10"(Top Lock)
Excellent wiper blade set for my 2024 Honda CR-V - a perfect fit! Easy to replace the front blades and these are very quiet and do a great job with no streaking at all. Instructions included for the front blades are good. Either lost or couldn't find the rear window instructions, so went on YT for a quick video (for removing the old blade - installation is super easy) and it was an easy replacement. Replaced OEM blades, and these are every bit as good and the price is good. Old blades lasted a couple years, don't think I'll wait that long this time - these are nice blades and easy to replace and worth replacing every year. Very smooth, no streaking, quiet... in short they work great! Recommend for your CR-V - per above they're as good or better than OEM blades. New year with new wiper blades!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
R
Verified Purchase
robert johnson
Lake Worth, US
★★★★★ 5
Easy installation
Size: 26"+16"(Top Lock)
Perfect fit and just in time. Went to 4 places and no one has this style. As good as the dealer and a third of the price. Very happy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
R
Verified Purchase
Retired Appliance Dude
Chelsea, US
★★★★★ 5
Much higher quality then I ever expected at a great price
Size: 26"+17"+14"B(U/J Hook)
Perfect fit on my 2023 Mazda 3, they look and install exactly like the original OEM wipers but Mazda 3 can be a little tricky to install but if you search on the internet you will find plenty of helpful videos. They work really well without streaking or noise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Excellent front wipers, rear slightly shorter than expected
Size: 22"+21"+11"(U/J Hook), Size: 22"+21"+11"(U/J Hook)
I purchased the 22", 21", and 11" windshield wiper blade set for my 2017 Jeep Grand Cherokee. The front windshield wipers (22" and 21") work perfectly—smooth, quiet, and they clean the glass very well with no streaks. Regarding the rear wiper (11"), it does work properly and gets the job done. However, it is slightly shorter than the one I previously had installed. To be fair, I did not measure my old rear wiper, but it appears the one on my vehicle was a 12" blade, even though this listing specifies 11". Overall, I’m satisfied with the performance, especially for the front wipers. Just keep in mind that the rear blade may be shorter than what you currently have installed, depending on your setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026

recommand products