SKU: 32353965755

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32353965755

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Marcus Gladney
Boise, US
★★★★★ 5
Excellent stand
Size: Dual, Style: Glass Free Stand
I love the functionality of this stand! It is very durable and stable. It does not require any form of anchoring to hold monitors. I have two 27 inch monitors attached to my stand with no problems. The stand can be moved in various direction with little effort. Excellent stand if you are looking to enhance your office space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2024
L
Verified Purchase
Linda
Draper, US
★★★★★ 5
Great Stand
Size: Triple, Style: Glass Free Stand
I am very happy with my purchase. This stand was very easy to put together and it is also extremely sturdy. Does exactly what I need it to do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
T
Verified Purchase
T Bayron
Cuba, US
★★★★★ 5
nice stand, quick easy setup
Size: Quad, Style: Glass Free Stand
nice stand, easy setup, I like that you mount the bracket to the monitor first and then hook it onto the stand. This makes for a quick and easy setup. You do have to wrench down on the screws to keep the monitors from moving. Also you may want to have 4 of the exact same monitors so they all are at same height. I have two that are the same and two others that are different so they dont all mount at same level. I plan on ordering monitors to match.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
C
Verified Purchase
Chris Williams
Waukegan, US
★★★★★ 4
Hard to stand alone, bulky
Size: Triple, Style: Steel Free Stand
Did not fulfill my need
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
T
Verified Purchase
Ted Pavlic
San Leandro, US
★★★★★ 5
Fantastic upgrade from my original stand. Base is a little bulky, but stand is versatile and sturdy.
Size: Single, Style: Free-Standing, Size: Single, Style: Free-Standing
Amazing value for this stand. I needed a stand with more degrees of freedom than the original one that came with my monitor, and this stand (which was inexpensive relative to the cost of the monitor) was a great purchase. The base of the stand is a little bulky/high, and the soft material on the bottom of it can rub off very easily if you let the stand catch the back edge of your desk. Otherwise though, the stand is extremely easy to install, and it provides far more degrees of freedom for rotation and translation than the original stand for my monitor. Now my monitor is sitting at a comfortable viewing angle closer to my desk tilted slightly upwards toward me. Just keep in mind that you have to tighten down the height and tilt adjustments (the things that would be affected by gravity). So, if you want to adjust those frequently, this stand might not be a great fit for you. That said, it does provide a hidden but easy-to-access spot to store the keys needed to loosen it up to make those adjustments. So, if you need to make those adjustments, you'll always have quick access to the necessary tools. Highly recommended for its price in particular.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2025

recommand products