SKU: 31366540087

Monkeypox virus A35R, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A35R, His TagProduct Specification Species MPXV Synonyms Mpox, Monkeypox Accession Q80KX2 Amino Acid Sequence Protein sequence(Q80KX2, Val57 Thr181, with C 10*His) MVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight 16kDa Purity >95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q80KX2
Amino Acid Sequence

Protein sequence(Q80KX2, Val57-Thr181, with C-10*His) MVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 16kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date receipt,-20℃ to -70℃ as supplied.
  • 1 month,2℃to 8℃ under sterile conditions after reconstitution.
  • Please avoid repeated freeze-thaw cycles.

Background

Monkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31366540087

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Daniel
Cuba, US
★★★★★ 4
My pit bull loves them.
Color: Purple
I picked up the Frienhund Tough Dog Toys 3-pack for my large, heavy chewer, and overall I’m pretty impressed. Right out of the box, the toys feel solid and well-made—definitely more durable than your average chew toy. My dog usually destroys new toys within a day or two, but these have held up significantly longer, which is a big win. They also do a great job of keeping him occupied. The shapes and textures seem to keep his interest, and I’ve noticed less destructive chewing on furniture since introducing these. That alone makes them worth it. The only reason I’m giving 4 instead of 5 stars is that while they’re very tough, they’re not completely “indestructible” (despite the claim). After a couple of weeks of heavy use, there are some visible wear marks. Still, compared to most other toys we’ve tried, these last much longer. Overall, a great option for medium to large dogs that are aggressive chewers—durable, engaging, and a solid value for a 3-pack.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
A
Verified Purchase
Ashleigh
Los Angeles, US
★★★★★ 5
Great Toys for Chewers
Color: Purple
Love these dog toys, they are so well-made and keep my Golden Retriever busy for hours. The variety of sizes is nice too, they aren’t heavy at all, but they sure hold their shapes , even with the constant chewing. The price was very reasonable, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
D
Verified Purchase
Danielle
Battle Creek, US
★★★★★ 5
Grateful for chewers!
Color: Purple
Very tough very durable. I have two dogs and they are still not into pieces so really good quality good value for your money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
D
Verified Purchase
Donnette Ford
Omaha, US
★★★★★ 4
Great product
Color: Purple, Color: Purple
My dogs loved these toys. Durable and apparently very coveted as my puppers “argued” over who got each one. Kept them playing and chewing for hours. Giving only 4 stars instead because I Wish the size was bigger because I have found that sometimes I don’t see it and stepping on it is Absolutely NO FUN.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
G
Verified Purchase
Gabby
Houston, US
★★★★★ 5
Rottweiler approved
Color: Purple
My Rottweiler puppies love these bones. I feel good about letting them play with these and not worry they will break or that they can choke because they are durable and a good size and weight. I like the variety and can put peanut butter on the crevices if I want to give as a treat. Worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products