SKU: 30966455546

Human CD8, hFc tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8, hFc tagProduct Specification Species Human Synonyms T lymphocyte differentiation antigen T8 Leu 2, MAL Accession P01732 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C hFc)

Product Specification


Species Human
Synonyms T-lymphocyte differentiation antigen T8/Leu-2, MAL
Accession P01732
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-hFc) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

Predicted MW: 43.7 kDa Observed MW: 55 kDa

Purity >95% by SDS-PAGE
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions. Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the MHC class I protein. There are two isoforms of the protein, alpha and beta. The extracellular IgV-like domain of CD8-α interacts with the α3 portion of the Class I MHC molecule. Cytotoxic T cells with CD8 surface protein are called CD8+ T cells. Once the T cell receptor binds its specific antigen Lck phosphorylates the cytoplasmic CD3 and ζ-chains of the TCR complex which initiates a cascade of phosphorylation eventually leading to activation of transcription factors like NFAT, NF-κB, and AP-1 which affect the expression of certain genes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30966455546

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Emily T.
Boise, US
★★★★★ 5
Wedding prop
The perfect touch for our wedding. Our dog loved them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2025
G
Verified Purchase
goettagirl
Massapequa, US
★★★★★ 2
Adorable but not sturdy :(
These are adorable and were perfect for a little dog wedding but... 3 days later and one has already come apart. My dog is not a big chewer so I was shocked to see it in pieces. She was able to detach the squeaker from inside. On a larger dog this would likely be a choking hazard. I've had several other toys from Zippy Paws and never seen this happen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2024
B
Verified Purchase
Brandee Martinho
Bozeman, US
★★★★★ 5
The dogs loved it! Will buy again.
Style: Squeaky Chicken
My dogs have really enjoyed all the layers to this toy. It squeaks and has a noisy film on the inside of the cloth that they really like. The toy itself is very stiff and rigid but they like that. It’s been about 3 months and they recently broke through the pink layer so it lasts quite a while. It was a challenge for them to get the layer off once they had broken through the stitching so it would keep him occupied for a very long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
R
Verified Purchase
Randy C.
Chelsea, US
★★★★★ 5
My dog LOVES this, but...
Style: Squeaky Duck
My dog loved this right out of the box, she didn't learn to squeak it for a couple of hours, but she just stopped playing with her other toys, ragged as they may be... My dog is a Manchester/hound dog mix, of some sort, I'm only sure about the Manchester, she resembles them in look, size, weight, and all else. She weighs approximately 20-ish pounds, or so. With that said, like I said, she loves it, so much so that within 16 waking hours after its arrival she brought me the inner squeaker, the body was in the kitchen. :) She tore off the top part of the head and gained access to the squeaker, and EXACTLY as advertised and other reviews, it is a really good squeaky toy, she really doesn't seem to mind that the outer portion is gone, the (seemingly) durable squeaker might actually last. She can still play with the 'body', the toy is made that when (not if) they rip off an appendage, the nentire innards WILL NOT come out. It's a well designed toy in that respect. So, at times she will play with that too, she has brought me the BODY several times too, My dog is a really CRAZY chewer, she is somewhere under a year old and she will chew on anything that she is in front of her, including rocks, a blade of grass as she runs by, furniture legs, window sills, you name it, she has eaten it. She is a problem dog, but we picked her, and we'd do the same if it was our kid, we wouldn't throw them out. :) She has to be watched constantly, that is not the most fun, but, like they say, 'It is what it is'. I mention all of that to show that even though she is a crazy chewer, the rubber portion of the toy is still 'with us', for now, I will update this if anything else develops, and I am sure it will. Oh yeah, I really need to add, I don't think that the makers can make a chew toy 'outer' from anything that will last that long, not unless you go to a rope material, and I did not want that, it can be swallowed and cause more trouble. (Fabric can be swallowed too, but it's at least softer...) So, really, more than likely you can't get any better than this if your dog is a crazy chewer too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2023
A
Verified Purchase
Amanda Pike
Alexandria, US
★★★★★ 1
Awful Durability
Style: Squeaky Chicken
My dog had this toy for all of 30 minutes an COMPLETELY destroyed it. He is not an aggressive chewer, and has had plenty of rip and reveal toys from Bark Box last WEEKS. I thought I'd try out another brand, but I will be swiftly placing a Bark Box order. I am very disappointed in the durability and quality of this toy thay is supposed to survive non-agressive chewing. If I could give 0 stars, I would have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products