SKU: 29978959269

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29978959269

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
JohnnyD.
Lexington, US
★★★★★ 3
Mixed results using this auto can opener...
Color: Green
I had high hopes for this can opener, but was let down. This can opener failed me half of the times I tried to use it. For some reason it wouldn't cut through the paper surrounding the cans. I tried it on small, medium and large cans. It worked best on larger cans. I got it because I liked the idea of opening cans without having to contend with the sharp lids that inevitably fall back into the opened cans. It is unsanitary at best and a safety hazard at worst. On the plus side it is rechargeable, so no battery worries there. It fits nicely in the hand for ease of use. It appears to be of sturdy construction, so it's a high quality item. And being small it will store easily. The price is right and it represents a good value for your hard earned dollars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 27, 2025
C
CO DIYer
Carnegie, US
★★★★★ 5
Hands Free Operation; Safe Cutting
Color: Green
I used to have a manual (as in turn-the-crank) side-cutting can opener really liked it. It eventually wore out and I had relegated myself to the standard hand-crank top-cut version that often left a sharp lid and sometimes a little burr or sharp point where the cut wasn't complete and the you had to the tear/bend the lid off. With this mostly hands-free Side Cut Can Opener, sharp edges will be few, if any. I say "mostly hands-free" because you do have to position the opener on the can and push the button to start it and, when it finishes, you have to push the button again to tell it to stop. On the demo can in my video, the lip was such that the cut was right through that edge such that there were no sharp edges. It is possible that some cans may be designed such that the cutter falls below that rim and cuts the can edge in a way that leaves dull lid but a sharp can. These should be rare, but good to watch out for in case you get one. Always assume edges are sharp until you verify otherwise. You'll note in my video that the lid was a little difficult to remove. Some of that may be learning curve with this new opener, and some it may be that is just how it is! I accept that and choose to move forward using this new, safer can opener. Recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
M
Verified Purchase
Mishele
Dallas, US
★★★★★ 5
terrible item
it worked a few times and it doesnt work at all! Terrible item!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
Meek
Phoenix, US
★★★★★ 1
Very dangerous metal shavings!!!
Negative stars if I could. This is a very dangerous product. It worked well for a while. But then it quit effectively removing the lid instead I got little tiny shavings of metal around the edge. These shavings of metal go into the food and very dangerous. So this was a waste of money and incredibly dangerous. I am throwing it in the trash today.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
L
Verified Purchase
Lisandra Ramírez Galano
Louisville, US
★★★★★ 5
Practical and easy to use
This electric can opener performs its function well and gets the job done effortlessly. With just the press of a button, it opens cans quickly and smoothly—which is very useful, especially if you prefer not to exert physical force. The design is comfortable to handle and does not take up much space in the kitchen. The battery life is good, and it recharges without any issues. Overall, it is a functional product that makes an everyday chore much easier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026

recommand products