SKU: 28306121637

Human IL-1beta, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-1beta, His tagProduct Specification Species Human Synonyms Catabolin, IL1F2 Accession P01584 Amino Acid Sequence Protein sequence (P01584, Ala117 Ser269, with C 10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Predicted MW: 19. 0 kDa Observed MW: 19, 23 kDa Purity 90% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms Catabolin, IL1F2
Accession P01584
Amino Acid Sequence

Protein sequence (P01584, Ala117-Ser269, with C-10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 19.0 kDa Observed MW: 19, 23 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. IL-1β is a member of the interleukin 1 family of cytokines. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Increased production of IL-1β causes a number of different autoinflammatory syndromes, most notably the monogenic conditions referred to as Cryopyrin-Associated Periodic Syndromes (CAPS), due to mutations in the inflammasome receptor NLRP3 which triggers processing of IL-1B.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28306121637

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cleaver
Natrona Heights, US
★★★★★ 4
Best product I've tried so far but still temporary. YMMV.
Size: 1 Count (Pack of 1)
This product really does work. It is the best I've used. I purchased in September 2024 and am writing this review in May of 2026, roughly one year and 8 months later. I noticed product failure a little after a year after application and it has been degrading slowly since. Currently the product is visible like a layer of clear paint flaking off and you can physically scratch some off. Here are the pros and cons. Pros: Clarity, relative ease of use, value Cons: Taping and sanding, doesn't last for as long as you own your car as claimed Best used as a temporary fix. Bottom line, would I use it again? Yes. What am I doing today? Replacing the headlights completely. Why? I plan on keeping my car for longer than a year.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
S
Verified Purchase
Sahiti
Chelsea, US
★★★★★ 5
Review After Using on 3 Different Cars over 3 years
Size: 1 Count (Pack of 1)
Cerakote Headlight Restoration Kit : After Using on 3 Different Cars over 3 years This is my second time purchasing the Cerakote Headlight Restoration Kit, and I’ve now used it across three different vehicles. At this point, I feel comfortable saying this product genuinely works when used correctly. Before trying this kit, I considered replacing my headlights entirely. The cheapest replacement set I found was around $150 just for the parts. Installation would have required removing the grille, bumper, and other components, which adds time and complexity. For an older vehicle, that didn’t make financial sense. Instead, I chose to restore the original headlights. Cost and Value My first package cost me $17, and I restored two cars with that single kit ( about 9$ per pair). That alone made it worth it. For under $20: I restored two separate vehicles Avoided buying new headlight assemblies Avoided removing the bumper and grille Compared to a $150+ replacement plus labor, the savings are significant. Durability 1 year+ under direct Cali sunlight (currently on year 2 and still good) First Car – Learning the Process The first time I used the kit, my results were decent but not perfect. That was mainly because I didn’t fully understand how sanding and polishing actually work. ( this reoxidized fastest under 8 months, but it was mostly my fault) I didn’t initially realize: The headlight needs to stay wet during sanding Oxidation must be completely removed before applying clear coat Even pressure matters/ 50% overlap coverage when appling ceramic Once I understood that sanding is the most important step, everything improved. Second Car (beater) Major Improvement The second vehicle was heavily oxidized and yellowed. I used the remaining material from that same $17 kit and restored it completely. The clarity difference was dramatic. It looked close to factory condition, and night visibility noticeably improved. That was when I realized the product itself is solid; the key is proper technique. Third Car ; Recent purchase By the third car, the process felt straightforward. I followed the instructions carefully, kept the surface wet while sanding, and applied the clear coat evenly in one smooth pass. The final result was clear, glossy, and uniform. No haze, no streaking. Durability On my first vehicle, the restoration lasted close to a year perfectly( I sold that car this year and it still had clear headlights), and that car was parked outside in direct sun most days. For a DIY kit at this price point, that level of durability is impressive. Final Thoughts I seriously considered spending $150 on replacement headlights( this was cheapest ) and dealing with removing body panels. Instead, I spent $17 and restored two cars. Now having used it on three vehicles, I can say this kit is effective, cost-efficient, and worth the time if you follow the process properly. It does require effort and patience, but the results justify it. I would purchase it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
Y
Verified Purchase
YetAnotherITGuy
Grantham, US
★★★★★ 5
works as advertised!
Size: 1 Count (Pack of 1)
I purchased this kit to renew the headlights on my 2016 Nissan Frontier pick-up. The headlights had become slightly oxidized and dull -- not that bad but it was bothering me and for the price of the kit I figured it was worth the effort to attempt to renew them. All I can say is -- WOW, what a difference. The end result looked like new -- clean, brilliant and bright. Read the directions (2 or 3 times) and follow them EXACTLY. Total time for me from opening the kit to being done was about 2 hours and I was taking my time. This kit is different in that the final step applies a UV resistant coating which really makes the glass super transparent. Great investment in the time and money. I can't stop admiring my new (old) headlights!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
A
Verified Purchase
Alex
Draper, US
★★★★★ 5
Incredible Results! The "Z-Line" is Back!
Size: 1 Count (Pack of 1), Size: 1 Count (Pack of 1)
I’ve tried a few "wipe-on" fixes in the past, but the CERAKOTE® Ceramic Headlight Restoration Kit is in a completely different league. If you are tired of hazy, yellowed lenses and weak nighttime visibility, look no further. 📖 Instructions & Ease of Use The first thing that stood out was the clarity of the instructions. The kit breaks everything down into a simple, step-by-step process. Even if you aren't a "car person," the directions are foolproof. They don't just tell you what to do; they explain why each step matters, which gave me the confidence to get the job done right the first time. ✨ Restoration Effectiveness As you can see in my Before and After photos, the transformation is night and day. My headlights went from a dull, oxidized yellow to a factory-fresh, crystal-clear finish. It didn't just "clean" them—it completely rejuvenated the plastic. 🔦 The Real Test: Light Output & Beam Pattern The most impressive part isn't just how the car looks, but how it performs at night. I’ve included a photo of my car parked against a wall in the dark to show the comparison: Passenger Side (Restored): You can see a sharp, distinct cutoff line and the perfect "Z-line" pattern. The light is focused exactly where it needs to be on the road. Driver Side (Not Restored yet): The light is completely distorted. There is no cutoff, just a messy blob of light that scatters everywhere, likely blinding oncoming traffic while providing less actual visibility for me. Final Verdict This kit doesn't just make your car look better; it’s a genuine safety upgrade. Seeing that crisp Z-line back on the wall proves that the clarity is internal as well as external. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
S
Verified Purchase
Shadetree
Bozeman, US
★★★★★ 5
Like it came from the factory
Color: 2024-2025 Black
The texture and color matches the factory interior and the shape and size of the handle is a mirror image of the passenger handle from the factory. Installation is quick and easy - it takes only five minutes. Great product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026

recommand products