SKU: 27928171045

Human VEGF 165, His tag

Sale price$128.25 Regular price$142.50
Save 10%

Pay in installments of $35.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 165, His tagProduct Specification Species Human Synonyms Vascular permeability factor (VPF), VEGF Accession P15692 4 Amino Acid Sequence Protein sequence (P15692 4, Ala27 Arg191, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 20. 9 kDa Observed MW: 25 kDa Purity

Product Specification


Species Human
Synonyms Vascular permeability factor (VPF), VEGF
Accession P15692-4
Amino Acid Sequence

Protein sequence (P15692-4, Ala27-Arg191, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Predicted MW: 20.9 kDa Observed MW: 25 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF or VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family. Humans express alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF165 appears to be the most abundant and potent isoform, contains basic heparin-binding regions and is not freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. VEGF165 binds the semaphorin receptor, Neuropilin-1 and promotes complex formation with VEGF R2. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells. In adults, VEGF functions mainly in wound healing and the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels correlate with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and systemic lupus erythematosus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27928171045

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Josefin Olsson
Charlottesville, US
★★★★★ 2
Cute but disappointing
Color: C-Navy+Oak, Color: C-Navy+Oak
One of my dogs love these however they are far from indestructible. Two days after giving the teddy to him, the tail of the teddy is off and there is a rip by one of the arms. They are very cute teddies but not for heavy chewers as they will only last a few days.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
F
Verified Purchase
FORESTVILLE MOM
Louisville, US
★★★★★ 4
Nothing is indestructible
Color: D-Purple
Adorable. Looks just like the photo. My 15# JRT loves it! however the tail and one ear were gone in a matter of minutes. It’s his toy so I’m just monitoring his time with it as it’s his favorite 😍
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Alex
Waukegan, US
★★★★★ 5
Our Pit Bull’s Favorite Toy!
Color: A-Navy, Color: A-Navy
We absolutely love this MAXBECK bear toy! We’ve ordered it 4 times over the last 8 months because our senior pit bull is obsessed with his “babies.” He always has one close to him and even cuddles with them. The material is very sturdy and holds up amazingly well even with rough play. My dog’s favorite part is the squeaker. What I love most is that even after he finally tears into it, the rope built inside becomes a whole second toy for him and keeps the fun going. If you have a heavy chewer who destroys toys quickly, this one is definitely worth trying!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
M
Verified Purchase
MEV
Alexandria, US
★★★★★ 3
Not indestructible
Color: C-Navy+Oak, Color: C-Navy+Oak
I assume it is probably hard to create an indestructible product, but my puppy had it apart in no time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
N
Verified Purchase
Nirpno
Battle Creek, US
★★★★★ 2
NOT DURABLE, LONG-LASTING, OR USEFUL
Color: A-Navy, Color: A-Navy
I gave this dog toy 2-stars based on my dog toy rating system (DTRS) for “Albert” the Blue Bear! Safety (1-rating): Albert fell apart after 4-hours of use. 1. The ears were chewed off and I was only able to find one of them, which means my dog swallowed the other ear. Very big concern as it depends on how big your dog is to pass this object. The ear is about the size of 1.5-quarters. 2. The tail was almost chewed off entirely and was hanging on by a thread before I threw it out. 3. After the ears came off, the inside foam started to come out, which raised my concern for my dog’s saftey. 4. The entire body was soft and did not cause any harm to teeth, gums, paws, nose, etc. Durability (3-rating): 1. The ears and tail are the weakest parts of Albert as they can easily be chewed off. 2. The body is durable enough to sustain 4-hours of use, as I threw Albert out after the ears and tail were torn off within 4-hours. 3. The small squeaker inside Albert’s belly was broken after 15-minutes of use. Thank Goodness! 4. My next concern was how long the arms and legs would last; TBD! Squeaker (1-rating): 1. Small plastic squeaker, the size of a half-dollar, with a high pitched noise. Fatality (2-rating): 1. Albert was put to rest after 4-hours of use as I was concerned for the safety of my dog with continued use. 2. If Albert didn’t come with ears or a tail, I can only imagine how long he would’ve survived as the material seemed to be durable enough to withstand continued use. In conclusion, “Albert” the Blue Bear is not worth the money for a toy that falls apart after 4-hrs of use and with the concerns of safety. I was surprised that it was only 8-inches tall, next time I’ll confirm the size of the toy before I purchase the next one. About my dog “Cannoli” for comparison: Breed: Blue Healer / Lab mix Weight: 40-lbs Energy Level: High Age: 7-months Chew Rating: Aggressive
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2025

recommand products