SKU: 2728261767

Human INOS, His tag

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human INOS, His tagProduct Specification Species Human Synonyms Hepatocyte NOS (HEP NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl cysteine S nitrosylase NOS2, NOS2A Accession P35228 Amino Acid Sequence Protein sequence (P35228, Ala2 Cys200, with C 10*His)

Product Specification


Species Human
Synonyms Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A
Accession P35228
Amino Acid Sequence

Protein sequence (P35228, Ala2-Cys200, with C-10*His) ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 43-55 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2728261767

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
lighthead
Belleville, US
★★★★★ 5
Absolutely buy this insurance for any product you care about!
I usually don't buy the protection plan for appliances, but the combination of previous experiences with milk frothers that inexplicably and quickly failed taught me to do so this time with my Maestri House milk frother, bought for $70. I'm so glad I did! It shorted out at 22 months, and the company refused to help. I filed my claim with Asurion, got a return label immediately, sent it back that day, and was notified within a couple of days that the total cost of the frother was now ready and waiting for me in my Amazon account. It was so easy, so seamless, and so quick! I researched new (non-Maestri House) frothers, and bought a highly-praised one for the same price--with another 3-year plan from Asurion. So well worth a few more dollars to protect an appliance that I can't start my day without!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
A
Verified Purchase
ALEXANDER
Pawtucket, US
★★★★★ 1
First time claim with Asurion, definitely SHADY
This whole thing is really shady. I just called to file a claim for a juicer that I purchased at the same time for coverage. The guy asked for my name, address, than wanted my claim number.... but I was calling to file a claim. I told him I had an order number, so he said Yea give me that. "Now I need your 16 digit credit card number. Thats when I STOPPED. I asked him how does this process work. He said I needed to give him my credit card number first. I repeated ... "can you just tell me how this is going to process so I understand". He then said, "thank you have a blessed day" and hung up. Not odd disconnected, he just hung up. I don't think I'll be buying the Asurion protection anymore. I'll try amazon direct and give an update if I have one. March 12, 2026
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
B
Verified Purchase
beckyod
Phoenix, US
★★★★★ 5
So Worth It!!
My Keurig died and I went to order another one. I did "buy it again" because I really loved the last one. It showed my purchase date and I was suprized that I hadn't been it that long. I had purchased the protection plan and decided to go ahead and see if they would cover it, thinking that it would be too complicated to complete, but......It literally took less that ONE MINUTE!!! I printed the return label, took it to the UPS store and within hours had a gift card to my Amazon account! I always add Asurion, but this was the first time I had to use it!!! TOTALLY WORTH the $8 for 3 years protection!! Thank You so much Asurion!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
V
Verified Purchase
vicki
Birmingham, US
★★★★★ 5
Great price great plans
Anyways a pleasure to work with asurion. Great plans
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
W
Verified Purchase
William
Waukegan, US
★★★★★ 5
Quick and easy claim process.
I had problems with my Sous Vide and the manufacturer warranty expired 1 year ago. I made a claim with Asurion and they immediately sent me a return label. I returned the old Sous Vide and I was sent an amazon gift card to purchase a new Sous Vide within a couple of days.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026

recommand products