SKU: 26647212929

LILRB3/CD85a/ILT5 His Tag Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB3/CD85a/ILT5 His Tag Protein, HumanProduct Specification Species Human Accession O75022 Amino Acid Sequence Gly24 Glu443, with C terminal 8*His

Product Specification


Species Human
Accession O75022
Amino Acid Sequence Gly24-Glu443, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 60-75kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific.

LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26647212929

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Phanessa Hernandez
Boise, US
★★★★★ 3
It’s alright.
Size: Queen, Number of Items: 2
Not bad pillows. They are comfortable but mine came with an odd odor, kind of mildewy smell to it. Had to spray it down to tolerate sleeping on it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
A
Verified Purchase
ALEXANDRA W.
San Leandro, US
★★★★★ 5
Nice pillows
Size: Queen, Number of Items: 2
Have had these a few months and so far really like them! They don’t really feel very cooling, but I also run VERY HOT so it could just be me. The foam holds up well and hasn’t flattened like others I’ve tried. They come very compacted- I was shocked how much they expanded!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
B
Verified Purchase
Balous belote
Lowell, US
★★★★★ 5
Mr.b
Size: Standard, Number of Items: 2
The pillows are cool and comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jennifer
New York, US
★★★★★ 5
Awesome Pillow!!!
Size: Queen, Number of Items: 1
This pillow is Amazing!!! So Great to sleep on. I finally can get a good night's sleep!!! Its very soft and comfortable. I also haven’t gotten up with a stiff neck in the morning either!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
A
Verified Purchase
Adam Rigdon
Cuba, US
★★★★★ 5
Love them!!
Size: Queen, Number of Items: 2, Size: Queen, Number of Items: 2
Ok I normally don't leave reviews but I had to on this pillow. I was looking forever for a pillow and was nervous about buying one because you know how that usually goes when it comes to buying pillows. They arrived compressed but when you unwrap them they blow up to be a heavy duty pillow. Firm but not too firm. I don't like super soft pillows that you can roll up in a ball with one hand, I like a pillow that gives support and these do just that. They are cooling as well they are pretty for a pillow with the unique design. If you are in the market for a pillow and reading this THEN BUY THIS PILLOW & come back to tell me thank you. I promise you will NOT be disappointed. No I didn't get paid to say any of this. I wanted to give a honest review where it deserves one! You will not be disappointed! Thanks for the fast over night shipping as well. Not to mention the pricing is on point. I can say right now you will not find 2 pillows of this quality & price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026

recommand products