SKU: 2492859392

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag TagProduct Specification Species Human Synonyms CD8 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C Acidic Tail His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19 Pro170, with C Basic Tail Flag tag)

Product Specification


Species Human
Synonyms CD8
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-Acidic Tail-His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19-Pro170, with C-Basic Tail-Flag tag) NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Expression System HEK293
Molecular Weight Predicted MW: 23.9 kDa(CD8A)&22.7 kDa(CD8B) Observed MW: 30, 35 kDa under reducing (R) condition, and 65-72 kDa under non-reducing (NR) condition
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein expressed on cytotoxic T lymphocytes, serving as a coreceptor for the T cell receptor (TCR). It exists primarily as a CD8αβ heterodimer or a CD8αα homodimer, each chain belonging to the immunoglobulin superfamily. Functionally, its extracellular IgV-like domain binds the α3 domain of MHC class I molecules, stabilizing the TCR-antigen interaction. Concurrently, its cytoplasmic tail recruits the kinase Lck to initiate intracellular signaling cascades crucial for T cell activation and target cell killing. CD8 is thus essential for adaptive immunity against viruses and tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2492859392

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BGK^2
Port Orchard, US
★★★★★ 5
2010 Subaru Outback CVT fluid 👍
Size: 5 Quart, Style: 1 Pack
2010 Subaru Outback CVT ... have been using this for several thousand miles instead of OEM fluid, and works just fine ... if your subie takes the "green" CVT fluid, this works excellent! I even used this after dropping the CVT valve body and replacing the lock up solenoid, so I had to replace with almost exactly 10 qts of fluid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
H
Verified Purchase
Henry
West Palm Beach, US
★★★★★ 5
Worth it
Size: 5 Quart, Style: 1 Pack
Expensive but good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
S
Verified Purchase
Sunny dhama
New York, US
★★★★★ 5
It Works! (Mustang 2016 ecoboost knocking noise)
Style: Modifier
I recently experienced a remarkable transformation in my 2016 Mustang Ecoboost, thanks to the LIQUI MOLY Oil Additive Cera Tec 3721. As someone with a passion for automobiles and a background as a software engineer, I'm always on the lookout for ways to improve my vehicle's performance. This product turned out to be a game-changer. One of the issues I had been facing with my Mustang was a persistent knocking noise, which can be quite concerning for any car enthusiast. After researching potential solutions, I decided to give LIQUI MOLY Cera Tec 3721 a try. And I must say, I was pleasantly surprised by the results. The primary reason I opted for this oil additive was its promise of ceramic wear and tear protection. As someone who values the longevity of my vehicles, I wanted to reduce engine friction and wear as much as possible. This product did exactly that. The moment I started using it, I noticed a significant reduction in engine noise, especially the knocking sound that had been bothering me. It provided a smoother engine performance, and the difference was noticeable. What impressed me even more was the impact on fuel consumption. As someone who loves to travel and has explored six states during my time in the USA, fuel efficiency is a key concern. LIQUI MOLY Cera Tec 3721 not only improved my engine's performance but also led to lower fuel consumption. This means fewer stops at the gas station and more miles of adventure. Moreover, being a mentor and research assistant, I appreciate the science behind this product. It's clear that LIQUI MOLY has put considerable effort into developing a high-quality additive that benefits both petrol and diesel engines. This is the kind of innovation that I believe will shape the future of the automotive industry. In conclusion, LIQUI MOLY Oil Additive Cera Tec 3721 has not only fixed the knocking noise in my Mustang but has also enhanced its overall performance. It's a product that aligns with my goal of staying at the forefront of technology and innovation in the IT sector, even when it comes to my car. I highly recommend it to anyone looking to improve engine performance, reduce friction, and achieve better fuel efficiency. It's a small investment with significant returns for your vehicle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2023
R
Verified Purchase
Robert Higginson
Charlottesville, US
★★★★★ 5
Skeptical...... to Believer
Style: Modifier, Style: Modifier
I've waited awhile to write this review, to see how time effected my opinion. A little background, my daughter really wanted a 328i, so I went out and found a clean, single owner vehicle with a little over 100k on it. Its the family's first BMW, but as a mechanic I've seen and worked on them all. The BMW N52 engine seems overly complicated for what it does. Power output and economy are just average even though its got just about every bell and whistle including variable valve timing. One thing that struck me was how noisy it was. Kinda like a quiet sewing machine. I changed the oil to Mobil 1 0w/40 Euro blend and she drove it for 7k miles. During this time I read up on all the LL/01 oils for this car, so next oil change I used Castrol Edge, which is LL/01 certified. No difference. Car runs well, still sounds like a sewing machine. 7k more miles go by, and I learn about this CeraTec additive, and decide to give it a try based on all the good reviews. Yup, looks like a Orange Julius!! Well, I dump it it, and take it around the block. Engine seems a little quieter and smoother, but figure its my brain screwing with me. I slam the hood, and give my daughter the keys back, and off she goes. And here's where it gets interesting.... My 19 year old daughter doesnt know squat about cars. She a 100% gas it up and go girl. So about 2 weeks after the CeraTec goes in we are sitting at the dinner table and she says... " Oh Daddy, I forgot to thank you for tuning up my car". I ask her what makes her think I did? She replies that since the last service its much smoother idling at red lights and its quieter. (Remember, she's driven it for 7500 miles at this point) I asked her how could she tell, as the radio is always at least half volume. She says when its running and she's got the window down ordering at a drive -thru it used to go "tickity-tickity" ( her words)as it echo'ed off the building.. and now its silent. I go out and fire it up and roll down the window and stick my head out.... yup. Silent and verrry smooth. She also has average MPG constantly on display , and its improved about .65 mpg. So, if you add all that up, it seems to work. Liqui-Moly says its lasts 30k miles. I service the car every 7k, so we'll see if this all stays the same after a service, which is coming up soon. The car uses zero oil between services, so I cant comment on that. But from a smoothness, quietness point of view, if my daughter noticed it without me prompting her, I would say thats what made me a believer more than anything. Thanks Liqui-Moly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2019
R
Verified Purchase
Ricardo
Grantham, US
★★★★★ 5
Great product
Style: Modifier
Noticed a more smooth engine idle and less tick noise in my Tacoma. Is a win
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026

recommand products