Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD9 , His tagProduct Specification Species Human Synonyms 5H9 antigen, Cell growth inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility related protein (MRP 1), Tetraspanin 29 (Tspan 29), p24, MIC3, TSPAN29 Accession P21926 Amino Acid Sequence Protein sequence(P21926, Ser112 Ile195, with C 10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11.
Product Specification
| Species | Human |
| Synonyms | 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein (MRP-1), Tetraspanin-29 (Tspan-29), p24, MIC3, TSPAN29 |
| Accession | P21926 |
| Amino Acid Sequence | Protein sequence(P21926, Ser112-Ile195, with C-10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.3kDa Actual:10kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD9 is a cell surface glycoprotein that consists of four transmembrane regions and has two extracellular loops that contain disulfide bonds which are conserved throughout the tetraspanin family. Also containing distinct palmitoylation sites that allows CD9 to interact with lipids and other proteins. CD9 is commonly used as a marker for exosomes as it is contained on their surface. CD9 has a diverse role in cellular processes as it has also been shown to trigger platelet activation and aggregation. CD9 can also modulate cell adhesion[24] and migration.[25][26] This function makes CD9 of interest when studying cancer and cancer metastasis. However, it seems CD9 has a varying role in different types of cancers. Studies showed that CD9 expression levels have an inverse correlation to metastatic potential or patient survival.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 7 reviews
Sort
Product Reviews
★★★★★ 5
Reliable Overnight Protection for Peaceful Sleep
Size: Size 3, Unit Count: 132
They provide excellent overnight protection and keep my baby dry through the night, which means fewer wake-ups and better sleep for everyone. The fit is snug but comfortable, and the waistband helps prevent leaks even with lots of movement. They’re soft, absorbent, and do exactly what they’re designed to do. A great choice for parents looking for dependable overnight diapers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
★★★★★ 5
Great for overnight or long plane rides
Size: Size 5, Unit Count: 50
We’ve been using these overnight diapers and they’ve worked really well for us. They hold a lot and have helped prevent leaks overnight, which has made a big difference for sleep.
They fit comfortably and don’t seem to bother my baby’s skin, even after wearing them all night.
Pros:
• Great overnight absorbency
• Help prevent leaks
• Comfortable fit
• No irritation for us
Cons:
• Slightly bulkier than regular diapers
• A bit more expensive than daytime options
Overall, these have been really reliable for overnight use and have helped us avoid middle-of-the-night changes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
★★★★★ 5
Amazing absorption power
Size: Size 3, Unit Count: 66
This is truly an overnight diaper and is worth every penny. They are typically fully loaded by the morning but my little one couldn’t be bothered. Or use them for an extended outing and have peace of mind their little bum won’t be wet. Great diaper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
★★★★★ 5
Baby sleeps through the night when she wears these
Size: Size 6, Unit Count: 72
I love the Huggies overnight! Can’t even tell you how many times I’ve ordered these. They’re the only diapers my daughter can wear overnight without waking up due to the diaper feeling too wet. She sleeps through the night when she wears these ones. They definitely absorb a lot and don’t have an odor as they fill up.
I always size up when I order these and have never had an issue or leaks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
★★★★★ 5
less early morning blowouts!
Size: Size 7, Unit Count: 68
As a mom of a very active toddler, finding a diaper that actually holds up overnight has been a journey. We recently switched to the Huggies Size 7 Overnites, and overall, I’m really glad we did.
First, the biggest win: way fewer blowouts. Before this, we were dealing with middle-of-the-night sheet changes more often than I’d like to admit. Since using these, that’s pretty much stopped, which alone has been a huge quality-of-life improvement for both me and my toddler.
They’re also super absorbent compared to regular diapers. My little one sleeps long stretches, and these definitely hold more overnight without feeling overly bulky or uncomfortable. The fit is snug but still flexible, which is great because he moves a lot in his sleep.
That said, they’re not 100% perfect for us. We still get the occasional small pee leak, especially if he’s had a lot to drink before bed or sleeps in certain positions. BUT—and this is important—it’s still so much better than what we were dealing with before. Instead of full outfit and bedding changes, it’s usually just slightly damp pajamas.
Overall, I’d absolutely recommend these to other parents dealing with overnight messes. They’ve significantly reduced our stress and cleanup, even if they’re not completely leak-proof for every single night.
If you’re on the fence and struggling with overnight blowouts, these are definitely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
recommand products
1997-2004 Chevrolet Corvette C5- Interior A Pillar Trim Set Light Oak
65.00
Sarah Ockwell-Smith 2 Books Collection Set (The Gentle Sleep Book, The Second Baby Book)
15.95
1997-2004 Chevrolet Corvette C5 Cooling Fan 24001282
75.00
Biff, Chip and Kipper Stage 1 - 5 Read with Oxford: 3+: 88 Phonics Books Collection Set
154.80
Thats not my 3 books set collection ( Otter, badger, squirrel )
18.99