SKU: 16216972906

Human SV2A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SV2A Protein, His TagProduct Specification Species Human Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736 Accession Q7L0J3 Amino Acid Sequence Protein sequence (Q7L0J3, Try480 Thr590, with C His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT Expression System HEK293 Molecular Weight Predicted MW: 14. 7 kDa Observed MW: 25 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736
Accession Q7L0J3
Amino Acid Sequence

Protein sequence (Q7L0J3, Try480-Thr590, with C-His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT

Expression System HEK293
Molecular Weight Predicted MW: 14.7 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Synaptic Vesicle Glycoprotein 2A (SV2A) is a membrane protein found in all synaptic vesicles, the organelles responsible for storing neurotransmitters in neurons. It is the ubiquitous and primary isoform of the SV2 family. SV2A plays a critical role in regulating the exocytotic release of neurotransmitters. It is essential for priming synaptic vesicles, a process that makes them ready for calcium-triggered fusion with the presynaptic membrane. It is the direct molecular target for the anti-epileptic drug levetiracetam, underscoring its therapeutic significance in modulating neuronal excitability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16216972906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Patrick D Moore
New York, US
★★★★★ 5
Great quality for price
Flavor Name: Unflavored, Size: 90 Count (Pack of 2)
Great value for the quantity and quality. Easy to swallow, no issues.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
H
Verified Purchase
Helena Ronide Pinchinat
Omaha, US
★★★★★ 5
Boosted Energy & Great Quality Cinnamon Supplement! ✨💪
Size: 60 Count (Pack of 1)
I’ve been taking these Ceylon Cinnamon Capsules for a few weeks now, and I’m honestly impressed with the results. I’ve noticed better energy levels throughout the day, less fatigue, and overall I just feel healthier. The capsules are easy to swallow, have no bad aftertaste, and the quality feels premium. I also like that they’re made with true Ceylon cinnamon, which is known to be a cleaner and safer option compared to regular cinnamon supplements. Great for supporting metabolism and daily wellness. Definitely a product I’ll continue using and highly recommend!” ✨💪
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
S
Verified Purchase
Stephen
Birmingham, US
★★★★★ 5
Noticeable Comfort and Joint Support
Size: 60 Count (Pack of 1)
The Ceylon Cinnamon Capsules – Extra Strength have been a great addition to my daily routine, and I’m genuinely impressed with the results. After consistent use, I noticed reduced knee pain, and the swelling in my knees has also gone down, which has made a real difference in day-to-day comfort and mobility. The capsules are easy to swallow and gentle on the stomach, which I really appreciate. Knowing this is Ceylon cinnamon—often considered higher quality than standard cinnamon—gave me confidence in the product, and it definitely feels well-made and thoughtfully formulated. Over time, I found that stiffness decreased and movement felt easier, especially after being on my feet for long periods. While results can vary from person to person, this supplement worked well for me and supported my overall joint comfort without any unwanted side effects. Overall, this is a high-quality cinnamon supplement that delivered real, noticeable benefits for my knees. If you’re looking for a natural supplement to support comfort and reduce inflammation-related discomfort, these extra-strength Ceylon Cinnamon capsules are absolutely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
J
Verified Purchase
Jerry Rogers
Belleville, US
★★★★★ 5
Good Product
Size: 60 Count (Pack of 1)
Easy to use, no bitter after-taste.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Julie b
Los Angeles, US
★★★★★ 4
To soon to tell.
Size: 60 Count (Pack of 1)
It's really too soon to tell. So far I have noticed a drop in my glucose level which is why I ordered this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026

recommand products