SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
James C Stringham
Houston, US
★★★★★ 5
Best dog snack around.
These are my dog’s favorite snacks in the world. They are fresh, healthy, and the dog thinks she’s getting a naughty snack because they’re sweet! 😆
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
D
Verified Purchase
Dian B.
Belleville, US
★★★★★ 5
Good treats
Dogs love these! We have Chihuahuas and have to cut these in half for them as a while one is too large.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
K
Verified Purchase
Kiki
Chelsea, US
★★★★★ 5
Healthy, Slightly Soft/Chewy Treat!
VERY pleased to have found these! Wanted something to offer Mookie as a "special treat" (a step up from Milkbones, but NOT long-lasting) that was healthy and easily digestible. He wasn't sure what to make of them at first... they're fairly soft and a little chewy, and they just smell like FRESH sweet potatoes -- not any fake meat or seasoning. Once he started chewing, however, he got very excited about the new treat, and now when he hears the bag being handled/opened, he comes running and does his little happy dance! We'll be keeping these on hand because the quality and reasonable price - combined with the LACK of tummy distress and his enjoyment - make this a "go-to" special reward.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
D
Verified Purchase
Dawn
Lake Worth, US
★★★★★ 5
A Nutritional Treat!
My German Shepherd loves this so much, I sometimes use it as a training treat! Sweet Potato is beneficial to dogs. The only complaint I have is the size consistency from bag to bag.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
S
Verified Purchase
Sandy H
Charlottesville, US
★★★★★ 4
They used to be soft and moist but not now
These used to be one of my dogs’ favorite sweet potato treats, but they’ve gotten too hard and thick to cut for their morning snack or cut for their puzzle pieces. Because they’re not only too hard to cut, they’re also too hard for them to eat. Both, my Maltese and Shih Tzu love sweet potato treats, but they leave the dry ones behind. Since something made the Shih Tzu so sick that I had to spend a small fortune at the vet trying to make her better, she avoids all dry treats now and unfortunately that includes a lot of necessary nutrients. I hope these go back to being soft and moist the way they used to be!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026

recommand products