SKU: 13834122973

IL-31 Protein, Canine

Sale price$152.10 Regular price$169.00
Save 10%

Pay in installments of $42.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-31 Protein, CanineProduct Specification Species Canine Synonyms IL 31,IL31,Interleukin 31 Accession C7G0W1 Amino Acid Sequence Ser24 Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH Expression System E. coli Molecular Weight 17kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Canine
Synonyms IL-31,IL31,Interleukin-31
Accession C7G0W1
Amino Acid Sequence

Ser24-Gln159 with C terminal 8*His

MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH

Expression System E.coli
Molecular Weight 17kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% Trehalose.
Reconstitution econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print.
2. Allergy. 2023 Jul 13. Online ahead of print.
3. Clin Exp Med. 2023 Jul 1. Online ahead of print.

Background

IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13834122973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
jj
Whiting, US
★★★★★ 4
A bit wider than I expected
Style: Coyote
I thought this was going to be a "flat" toy but was a bit surprised to see that it was more of a 3D shape than flat. It's unfortunately a bit too wide for my small/medium sized terrier so he really only grabs and chews on the tail and ears. It is pretty durable though and has held up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
B
Brande B
New York, US
★★★★★ 5
Toughest dog toy we've ever owned! Jasper approved!
Style: Elk, Style: Elk
If you are the owner of a "power chewer" who usually turns standard plushies into a snowstorm of stuffing in under five minutes, the HOUND2O Elk Stuffed Animal is the heavy-duty solution you’ve been looking for. This isn't just a toy; it’s a rugged piece of outdoor-grade gear that manages to stay "plush" while being nearly indestructible. Here is why this elk is the gold standard for aggressive chewers. The "Ballistic" Build The secret to its toughness lies in the materials. Unlike cheap fleece or thin polyester, the HOUND2O Elk is engineered for extreme durability. Ballistic Nylon Shell: The body is wrapped in high-denier ballistic nylon—the same type of material used in tactical gear. It’s incredibly resistant to punctures and tears from sharp canine teeth. Reinforced TPR Accents: The "antlers" and specific high-wear points are reinforced with Thermoplastic Rubber (TPR). This gives your dog a satisfying, grippy texture to gnaw on without compromising the toy’s structural integrity. Extreme Stitching: The seams are double-stitched and recessed, making it nearly impossible for a dog to find a "weak spot" to start a rip. Built for Adventure: This toy is marketed for "outdoor adventures," and it truly lives up to that branding: Water-Resistant & Buoyant: Unlike most stuffed animals that become soggy, heavy sponges, this elk is water-resistant and it floats. It’s the perfect companion for a trip to the lake or a game of fetch in the pool. Easy to Clean: Because the material is so dense, mud and slobber don't soak in deeply. A quick rinse with a hose or a wipe-down with soap and water makes it look brand new after a day in the dirt. High Visibility: The vibrant colors and distinct shape make it easy to spot in tall grass or murky water, so you won't lose it during a long-range game of fetch. Engaging (But Tough) Squeaker For many aggressive chewers, the goal is to "silence" the squeaker as fast as possible. Protected Internal Squeaker: The squeaker is buried deep within the ballistic layers, making it much harder for a dog to pinpoint and puncture. It provides that high-value auditory feedback that keeps dogs engaged without being an easy "kill point" for the toy. Performance at a Glance Durability - Ballistic nylon and TPR are a "power chewer" dream. Versatility - Floats, easy to clean, and works indoors/outdoors. Engagement - Mixed textures (nylon + rubber) keep dogs interested. Value - Outlasts 10 standard plush toys combined. The HOUND2O Elk is a 10/10 for any pet parent tired of throwing away shredded toys. It is incredibly tough, intelligently designed, and built to withstand the "ruffest" play. While no toy is truly 100% indestructible for every single dog, this is as close as a plush-style toy can possibly get. If your dog loves the "thrill of the hunt," try hiding this elk in some tall grass or bushes outside. Its tough shell can handle the brush, and it’s a great way to provide mental stimulation alongside a heavy chewing session!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
M
Verified Purchase
Melissa Withers
Pawtucket, US
★★★★★ 2
Not as durable as it looks
Style: Snake
Our half pittbull and half american bulldog tore this apart in 5min.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Amazon Customer
Whiting, US
★★★★★ 5
Good looking toy that has held up well
Style: Coyote, Style: Coyote
Very durable toy that our little dog especially loves. It's the perfect size for a small dog and she doesn't destroy toys anyway so it's been great. It does feel very durable though and would take our chewer a little while to get to it as well. I'm not sure it looks like a coyote but the dogs don't seem to mind. It's an attractive toy that looks great and is constructed well so it's not like a slobbery mess when left out. Good value for the money and would make a great gift because it looks higher quality than most toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
S
StarReviewer
Dallas, US
★★★★★ 1
May be ballistic nylon, but the seams are flimsy.
Style: Gator, Style: Gator
I really wanted my pup to like this toy because it looks great and feels solid at first. The design is fun, the material seems tough, and it definitely gives the impression that it can handle some rough play. Unfortunately, that didn’t turn out to be the case at all. After just about 5 minutes of play, the top seam split open and stuffing started coming out. This wasn’t even extreme chewing, just normal play, and it failed almost immediately. As you can see in the photos, the tear happened right along the top seam, which is exactly where you’d expect a toy to be reinforced. Once it opened up, the toy was essentially done. For something marketed as ballistic nylon, this was really disappointing. It might be fine for very gentle dogs, but if your dog has even moderate chewing habits, this likely won’t last. Based on my experience, I wouldn’t recommend it. especially at 19.99 which is the price at time of my review, I feel it does not offer good value for money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products