SKU: 12523567104

GIPR Fc Chimera Protein, Human

Sale price$342.00 Regular price$380.00
Save 10%

Pay in installments of $95.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GIPR Fc Chimera Protein, HumanProduct Specification Species Human Accession P48546 1 Amino Acid Sequence Arg22 Gln138, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P48546-1
Amino Acid Sequence Arg22-Gln138, with C-terminal Human IgG Fc RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 45-54kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Glucose-dependent insulinotropic polypeptide receptor (GIPR) are G protein-coupled receptors belonging to the secretin receptor super-family, also known as class B1. GIPR comprises an N-terminal extracellular domain (ECD), a central domain consisting of seven transmembrane α-helices, and a C-terminal, cytoplasmic domain that mediates intracellular signal transduction by physical association with the G protein. GIPR increases insulin secretion in hyperglycemia and stimulates glucagon release in hypoglycemia. It also plays an important role in adipogenesis, islet β cell proliferation and insulin release, and is associated with type 2 diabetes, obesity and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12523567104

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JCMIV63
Houston, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
D
Verified Purchase
DDD Projects
Los Angeles, US
★★★★★ 5
OG Style
I am a big fan of Bruno Marc shoes. Over the years they have provided comfortable and affordable boots and shoes. These blue, tan and white soled dress sneakers are no exception. They have a nice finished look that makes them both causal and dressy. The lightweight style is still warm enough for colder mid-west winters. The box of the toes is wide and comfortable. The insole is well padded and a pleasure to wear. This is another fine pair of shoes to add to my collection and yours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
P
Verified Purchase
Premium Reviews
Lowell, US
★★★★★ 5
Must buy: Comfort + Casual + Well Made / Ventilated
Size: 8, Color: Brown
Just buy it! I have put in roughly 15,000 steps in this shoes in 10 days and I can't believe how comfortable they are after this much rough use in short amount of time. I highly recommend this shoes to anyone looking for comfort in casual style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
W
Verified Purchase
William W.
Lowell, US
★★★★★ 5
WIDE Dress Shoes With SUPPORT
Size: 10.5, Color: Brown
I've seen dress shoes and worn dress shoes before, but these are simply the best dress shoes I've ever worn my entire life. 99% of dress shoes have the same problem, they have the thinnest little soles that offer no support. BRUNO MARC HAS SOLVED THE PROBLEM. These dress shoes not only support wide feet like mine who historically have had and still have little support in the market, but Bruno Marc has wide options that fit perfectly, and the support with the thick foam sole is so needed and awesome. I had a pleasant surprise putting these things on and there being some tactile grip enhancers inside the shoe so you can feel the shoes better and get a little tickle / massage while you're at it. These things are dripping with style, easy to wear, and while they might look firm on the outside, on the inside the shoe just has such a nice flexibility and foamy feel, the top where the top of your feet feel the roof of the shoe, it has such perfect ooey gooey support I can't believe it. The outside sole also has this neat tactile feel. The durability looks good and feels good for now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2025
P
Verified Purchase
Paulie G
Belleville, US
★★★★★ 5
Amazing Shoes
Size: 9, Color: Brown
This is my first time wearing a Bruno Marc MaxFlex Dress Sneakers Oxfords Casual Wingtip Brogue Shoes. I was quite impressed how the shoes arrived and how they had a protection bag over each shoe. Very impressed by that, The shoes are very comfortable , lightweight squishy and affordable and very stylish. I recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026

recommand products