SKU: 65578841527

LL-37

Sale price$58.50 Regular price$65.00
Save 10%

Pay in installments of $16.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: [LL-37, 37 aa] Molecular Weight: 4493. 33 g mol

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

  • Sequence: [LL-37, 37 aa]
  • Molecular Weight: 4493.33 g/mol
  • Purity: >95%
  • Available in 10mg vials

Research Applications:

  • Antimicrobial mechanism studies
  • Innate immunity investigations
  • Wound healing research
  • Anti-biofilm activity analysis

Why Source LL-37 From Us?

  • Rigorous quality control ensures consistent purity
  • Comprehensive documentation, including certificates of analysis
  • Competitive pricing for research budgets
  • Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65578841527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Corky
Bozeman, US
★★★★★ 4
waist is small
Very cozy, warm, waist is very small although they fit everywhere else. I have an average waistline, not thick through the middle. I had to make a slit in the waistband and cut the elastic. Otherwise they would have been too tight to be comfortable. I have washed them several times and the slit I made in the fabric hasn't raveled or gotten any bigger. I'm happy with these, they keep me warm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
T
Verified Purchase
Tweet T Georgia
Chelsea, US
★★★★★ 5
Perfect !
Just as advertised, my elderly Mom loves these bedsure fleece fuzzy pajamas, the color is as shown, they washed up great, they are very thick and well made, they keep her very warm and are super soft ! The size was perfect too. She loves that the shirt has pockets, and although they fit her perfect, she wish the waist was drawstring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
P
Verified Purchase
Pat Beaver
Birmingham, US
★★★★★ 5
Softest warmest set ever
So warm and comfy, softest material, best thing ever for these cold winter nights, washes beautifully,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
N
Verified Purchase
Nini
Natrona Heights, US
★★★★★ 5
Great pjs
I ordered a medium and it’s much too large for me! I gave it as gift to a family member. I’m 4’11”. And 105 lbs.. I love the softness and warmth of the pjs. My daughter loves them and medium is prefect for her. The quality of the material is wonderful and designed prefect the weight of the fabric is just right!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
T
Verified Purchase
terry asmus
Whiting, US
★★★★★ 3
Light weight..very warm
My mistake because living in Texas this is way too warm to wear...would be great in cold weather climates.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026

recommand products